Recombinant Full Length Protein St7 Homolog(F11A10.5) Protein, His-Tagged
Cat.No. : | RFL1285CF |
Product Overview : | Recombinant Full Length Protein ST7 homolog(F11A10.5) Protein (Q19337) (1-536aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-536) |
Form : | Lyophilized powder |
AA Sequence : | MACSWTFLWLLWIALVAVLLFALRGPLKISESLESVTATSYFNNLTPKFYVALTGTSSLV SGIILIFEWWYFKNNAGIDAGDEEGSDNDESIENTKTVPECKVWRNPMALFRAAEYNRFR KETNSEPLTYYDMNLSAQDHQSLFMCDEDQGRAEYEIMQVAWRERESEERIQTARAALAI NPECASALVLLAEEESETVSQAENLLRRALRAIESTLNSYSNNQIASYAQNGDAVRKRDL TIQTYIKRRLAMCARKQGRLREAIKGFRDLSRDQSLSTLLSVQDNLIEACLEVQAYADVQ NLLVRYDGYGAPCSYELREPRSAAMSYTSALLKVRAVAENFRCAADSSIRRGLSSAEQTA IEALTRAMEFNPHVPPYLLELRSMIMPPEHFLKRGDSEALAYAFFHIQHWKRIDGALQLL SIVWKDFVPKVSKDKNAFSSQLESADKELLPSWHEQSVFPKTEGTLMMLLQTFICLAICI LAVLAQQFPASSGEIFRTAATIGMQFYENSVYTVSQWAPGNIIPYLASKQVPVPEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F11A10.5 |
Synonyms | F11A10.5; Protein ST7 homolog |
UniProt ID | Q19337 |
◆ Recombinant Proteins | ||
IDH2-2013R | Recombinant Rhesus Macaque IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACP2-46H | Recombinant Human ACP2 Protein, His-tagged | +Inquiry |
TAOK3-733H | Recombinant Human TAO Kinase 3 | +Inquiry |
Nrap-1858R | Recombinant Rat Nrap Protein, His-tagged | +Inquiry |
Ac-gp64-292A | Recombinant AcmNPV Ac-gp64 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
LDL-402H | Native Human Low Density Lipoprotein, High Oxidized, DiI labeled | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX4-1375HCL | Recombinant Human STX4 293 Cell Lysate | +Inquiry |
PTGR2-2707HCL | Recombinant Human PTGR2 293 Cell Lysate | +Inquiry |
SLC4A1AP-1711HCL | Recombinant Human SLC4A1AP 293 Cell Lysate | +Inquiry |
ACY1-3095MCL | Recombinant Mouse ACY1 cell lysate | +Inquiry |
IL23R-1429CCL | Recombinant Cynomolgus IL23R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F11A10.5 Products
Required fields are marked with *
My Review for All F11A10.5 Products
Required fields are marked with *
0
Inquiry Basket