Recombinant Full Length Prochlorococcus Marinus Photosystem I Reaction Center Subunit Xi(Psal) Protein, His-Tagged
Cat.No. : | RFL30906PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Photosystem I reaction center subunit XI(psaL) Protein (A3PF09) (1-199aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-199) |
Form : | Lyophilized powder |
AA Sequence : | MSDFQKSFSESTSSIKFDEKYIDTSVQPNDIGVAEQWAVKTVADPCVGNLATPVNSGYFT KAFINNLPFYREGISPNFRGLETGAAFGYLLYGPFTMTGPLRNSEFALTAGLLATIGAVH ILTALFVLYNAPGKAPNVQPPDATVNNPPKDLFTRAGWADFTSGFWLGGCGGAVFAWLLV GTLHLDSIMPIIKNIWTAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psaL |
Synonyms | psaL; P9301_17111; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L |
UniProt ID | A3PF09 |
◆ Recombinant Proteins | ||
RFL6800HF | Recombinant Full Length Human Olfactory Receptor 6A2(Or6A2) Protein, His-Tagged | +Inquiry |
SVS5-5851R | Recombinant Rat SVS5 Protein | +Inquiry |
METS-0851B | Recombinant Bacillus subtilis METS protein, His-tagged | +Inquiry |
VAMP1-12573Z | Recombinant Zebrafish VAMP1 | +Inquiry |
NUTM1-3285H | Recombinant Human NUTM1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-18H | Native Human Cardiac Troponin complex | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPHOSPH8-4237HCL | Recombinant Human MPHOSPH8 293 Cell Lysate | +Inquiry |
SH3KBP1-1600HCL | Recombinant Human SH3KBP1 cell lysate | +Inquiry |
GARS-6020HCL | Recombinant Human GARS 293 Cell Lysate | +Inquiry |
BPNT1-8415HCL | Recombinant Human BPNT1 293 Cell Lysate | +Inquiry |
CNKSR3-001HCL | Recombinant Human CNKSR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psaL Products
Required fields are marked with *
My Review for All psaL Products
Required fields are marked with *
0
Inquiry Basket