Recombinant Full Length Odontella Sinensis Photosystem I Reaction Center Subunit Xi(Psal) Protein, His-Tagged
Cat.No. : | RFL32769OF |
Product Overview : | Recombinant Full Length Odontella sinensis Photosystem I reaction center subunit XI(psaL) Protein (P49486) (1-150aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Odontella sinensis (Marine centric diatom) (Biddulphia sinensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-150) |
Form : | Lyophilized powder |
AA Sequence : | MANFIKPYNDDPFVGHLATPITSSSITRAILKNLPAYRFGLTPLLRGLEIGLAHGYFLMG PFVKLGPLRNSDIALFSGFLSTIGLILILTLGLTIYGVAAFGQGQTTENSNDLQTKKAWD QFKGGFFVGACGSAGFALICLSSIPAFTIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psaL |
Synonyms | psaL; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L |
UniProt ID | P49486 |
◆ Recombinant Proteins | ||
EPPIN-WFDC6-2875H | Recombinant Human EPPIN-WFDC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGDS-101H | Recombinant Human Prostaglandin D2 Synthase 21kDa (Brain), His-tagged | +Inquiry |
TJP2-3246H | Recombinant Human TJP2, His-tagged | +Inquiry |
TIGIT-120C | Recombinant Cynomolgus/Rhesus macaque TIGIT protein, Fc-tagged | +Inquiry |
TMEM128-5060H | Recombinant Human TMEM128 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
COL2A1-15C | Native Chicken COL2A1 Protein | +Inquiry |
HB-41D | Native Dog Hemoglobin (HB) Protein | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
HEY1-5575HCL | Recombinant Human HEY1 293 Cell Lysate | +Inquiry |
FAM108A1-6459HCL | Recombinant Human FAM108A1 293 Cell Lysate | +Inquiry |
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
FFAR1-6257HCL | Recombinant Human FFAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psaL Products
Required fields are marked with *
My Review for All psaL Products
Required fields are marked with *
0
Inquiry Basket