Recombinant Full Length Thermosynechococcus Elongatus Photosystem I Reaction Center Subunit Xi(Psal) Protein, His-Tagged
Cat.No. : | RFL27607TF |
Product Overview : | Recombinant Full Length Thermosynechococcus elongatus Photosystem I reaction center subunit XI(psaL) Protein (Q8DGB4) (1-155aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermosynechococcus elongatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-155) |
Form : | Lyophilized powder |
AA Sequence : | MAEELVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMAHGYFLI GPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQKGGSSSDPLKTSEGWSQ FTAGFFVGAMGSAFVAFFLLENFSVVDGIMTGLFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psaL |
Synonyms | psaL; tlr2404; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L |
UniProt ID | Q8DGB4 |
◆ Native Proteins | ||
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
Collagen Type I-04H | Native Human Collagen Type I | +Inquiry |
Histone-53C | Native Calf Histone Protein | +Inquiry |
Lectin-1827P | Active Native Pisum Sativum Agglutinin Protein, Agarose bound | +Inquiry |
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVRL1-1191CCL | Recombinant Cynomolgus ACVRL1 cell lysate | +Inquiry |
Spinal cord-459H | Human Spinal cord Liver Cirrhosis Lysate | +Inquiry |
PSME1-2742HCL | Recombinant Human PSME1 293 Cell Lysate | +Inquiry |
IL10RA-1185CCL | Recombinant Cynomolgus IL10RA cell lysate | +Inquiry |
TRMT12-755HCL | Recombinant Human TRMT12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psaL Products
Required fields are marked with *
My Review for All psaL Products
Required fields are marked with *
0
Inquiry Basket