Recombinant Full Length Prochlorococcus Marinus Nad(P)H-Quinone Oxidoreductase Subunit 3 Protein, His-Tagged
Cat.No. : | RFL12163PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus NAD(P)H-quinone oxidoreductase subunit 3 Protein (A2BUS5) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MFSLPGYEYFLGFLIIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhC |
Synonyms | ndhC; P9515_03271; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C |
UniProt ID | A2BUS5 |
◆ Recombinant Proteins | ||
TRAP1A-17302M | Recombinant Mouse TRAP1A Protein | +Inquiry |
RFL27470MF | Recombinant Full Length Tetrahydromethanopterin S-Methyltransferase Subunit E(Mtre) Protein, His-Tagged | +Inquiry |
Met-1744MAF555 | Active Recombinant Mouse Met Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TMEM177-9329M | Recombinant Mouse TMEM177 Protein, His (Fc)-Avi-tagged | +Inquiry |
AIF1-0310H | Recombinant Human AIF1 Protein (Ser2-Pro147), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
Hb-117M | Native Mouse Hb | +Inquiry |
LDL-405H | Native Human Low Density Lipoprotein, Acetylated | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
FGG-26469TH | Native Human Fibrinogen protein | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
LRRC59-394HCL | Recombinant Human LRRC59 lysate | +Inquiry |
CC2D1B-7798HCL | Recombinant Human CC2D1B 293 Cell Lysate | +Inquiry |
NNT-3777HCL | Recombinant Human NNT 293 Cell Lysate | +Inquiry |
C11orf84-8332HCL | Recombinant Human C11orf84 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhC Products
Required fields are marked with *
My Review for All ndhC Products
Required fields are marked with *
0
Inquiry Basket