Recombinant Full Length Oenothera Biennis Nad(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic Protein, His-Tagged
Cat.No. : | RFL30206OF |
Product Overview : | Recombinant Full Length Oenothera biennis NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic Protein (B0Z4U6) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oenothera biennis (German evening primrose) (Onagra biennis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MFLLYEYDIFWAFLIISSVIPILAFRISGLLAPTSIGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETIFLYPWALSFDILGVSVFIEALIFVLILVLGLVYAWRKGALEWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhC |
Synonyms | ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3 |
UniProt ID | B0Z4U6 |
◆ Recombinant Proteins | ||
CFL1P1-5221H | Recombinant Human CFL1P1 Protein, GST-tagged | +Inquiry |
CD300C-6886H | Recombinant Human CD300C, His tagged | +Inquiry |
RFL3104HF | Recombinant Full Length Heliobacterium Modesticaldum Cytochrome B6(Petb) Protein, His-Tagged | +Inquiry |
RFL32586MF | Recombinant Full Length Mouse Natural Killer Cells Antigen Cd94(Klrd1) Protein, His-Tagged | +Inquiry |
YXAJ-2295B | Recombinant Bacillus subtilis YXAJ protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KRT19-40H | Native Human KRT19 protein | +Inquiry |
Hld-730S | Active Native S. aureus delta Hemolysin Protein | +Inquiry |
Lectin-1803L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 594 labeled | +Inquiry |
Ferritin-179H | Native Human Ferritin | +Inquiry |
ECV-309S | Native Snake ECV- PROTHROMBIN ACTIVATOR | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCML1-1569HCL | Recombinant Human SCML1 cell lysate | +Inquiry |
NUAK2-3664HCL | Recombinant Human NUAK2 293 Cell Lysate | +Inquiry |
CLMP-8669HCL | Recombinant Human ASAM 293 Cell Lysate | +Inquiry |
CKMT1B-7482HCL | Recombinant Human CKMT1B 293 Cell Lysate | +Inquiry |
ZC3H10-208HCL | Recombinant Human ZC3H10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndhC Products
Required fields are marked with *
My Review for All ndhC Products
Required fields are marked with *
0
Inquiry Basket