Recombinant Full Length Physcomitrella Patens Subsp. Patens Nad(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic(Ndhc) Protein, His-Tagged
Cat.No. : | RFL10064PF |
Product Overview : | Recombinant Full Length Physcomitrella patens subsp. patens NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC) Protein (Q6YXR0) (1-121aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Physcomitrella patens subsp. patens (Moss) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-121) |
Form : | Lyophilized powder |
AA Sequence : | MFLLPKYNSFFIFLLLASVIPILAFSISKFLAPNNTQGPEKLTSYESGIEPMGDAWIQFQ IRYYMFALVFVIFDVETVFLYPWAMSFNDLGLSAFIEALVFVFILIIGLVYAWRKGALEW S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhC |
Synonyms | ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3 |
UniProt ID | Q6YXR0 |
◆ Recombinant Proteins | ||
LTBR-4589H | Recombinant Human LTBR Protein, GST-tagged | +Inquiry |
COASY-3655H | Recombinant Human COASY protein, His-tagged | +Inquiry |
LMNB1-1638HFL | Recombinant Full Length Human LMNB1 Protein, C-Flag-tagged | +Inquiry |
GIN1-1851R | Recombinant Rhesus monkey GIN1 Protein, His-tagged | +Inquiry |
BBS1-01HFL | Recombinant Full Length Human BBS1 Protein, N-His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
F5-284B | Active Native Bovine Factor V | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
A2m-8030M | Native Mouse A2m | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC17-4648HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
PNPO-3065HCL | Recombinant Human PNPO 293 Cell Lysate | +Inquiry |
SLC25A46-1758HCL | Recombinant Human SLC25A46 293 Cell Lysate | +Inquiry |
DYNC1H1-519HCL | Recombinant Human DYNC1H1 cell lysate | +Inquiry |
Skeletal Muscle-434H | Human Skeletal Muscle Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhC Products
Required fields are marked with *
My Review for All ndhC Products
Required fields are marked with *
0
Inquiry Basket