Recombinant Full Length Prochlorococcus Marinus Divinyl Chlorophyll A/B Light-Harvesting Protein Pcbe(Pcbe) Protein, His-Tagged
Cat.No. : | RFL24149PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbE(pcbE) Protein (Q9L8M2) (1-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-361) |
Form : | Lyophilized powder |
AA Sequence : | MQTYGNPDPTYGWWVGNSVVTNKSSRFIGSHVAHTGLIAFTAGANTLWELARFNPDIPMG HQGMVSIPHLASLGIGFDQAGAWTGQDVAFVGIFHLICSFVYALAGLLHSVIFSEDTQNS SGLFADGRPEHRQAARFKLEWDNPDNQTFILGHHLVFFGVANIWFVEWARVHGIYDPAIE AIRQVNYNLDLTQIWNHQFDFIQIDSLEDVMGGHAFLAFFQIGGGAFHIATKQIGTYTNF KGAGLLSAEAVLSWSLAGIGWMAIIAAFWCATNTTVYPEAWYGETLQLKFGISPYWIDTG NMDGVVTGHTSRAWLSNVHYYLGFFFIQGHLWHAIRAMGFDFRKVTSAVANLDNSRITLS D |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcbE |
Synonyms | pcbE; Pro_1450; Divinyl chlorophyll a/b light-harvesting protein PcbE |
UniProt ID | Q9L8M2 |
◆ Recombinant Proteins | ||
TOX2-3359H | Recombinant Human TOX2, GST-tagged | +Inquiry |
Lhb-1316M | Recombinant Mouse Lhb Protein, MYC/DDK-tagged | +Inquiry |
BOD1-3762H | Recombinant Human BOD1 Protein, GST-tagged | +Inquiry |
TFAP2A-9570Z | Recombinant Zebrafish TFAP2A | +Inquiry |
ZFP768-19068M | Recombinant Mouse ZFP768 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAI3-615HCL | Recombinant Human SNAI3 lysate | +Inquiry |
HA-2323HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
PECI-3310HCL | Recombinant Human PECI 293 Cell Lysate | +Inquiry |
IGFBP2-1457CCL | Recombinant Cynomolgus IGFBP2 cell lysate | +Inquiry |
CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcbE Products
Required fields are marked with *
My Review for All pcbE Products
Required fields are marked with *
0
Inquiry Basket