Recombinant Full Length Probable Sensor-Like Histidine Kinase Yehu(Yehu) Protein, His-Tagged
Cat.No. : | RFL21812EF |
Product Overview : | Recombinant Full Length Probable sensor-like histidine kinase YehU(yehU) Protein (P0AD15) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MYDFNLVLLLLQQMCVFLVIAWLMSKTPLFIPLMQVTVRLPHKFLCYIVFSIFCIMGTWF GLHIDDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSMGGMTALSCMISTIVEGLL GGLVHSILIRRGRTDKVFNPITAGAVTFVAEMVQMLIILAIARPYEDAVRLVSNIAAPMM VTNTVGAALFMRILLDKRAMFEKYTSAFSATALKVAASTEGILRQGFNEVNSMKVAQVLY QELDIGAVAITDREKLLAFTGIGDDHHLPGKPISSTYTLKAIETGEVVYADGNEVPYRCS LHPQCKLGSTLVIPLRGENQRVMGTIKLYEAKNRLFSSINRTLGEGIAQLLSAQILAGQY ERQKAMLTQSEIKLLHAQVNPHFLFNALNTIKAVIRRDSEQASQLVQYLSTFFRKNLKRP SEFVTLADEIEHVNAYLQIEKARFQSRLQVNIAIPQELSQQQLPAFTLQPIVENAIKHGT SQLLDTGRVAISARREGQHLMLEIEDNAGLYQPVTNASGLGMNLVDKRLRERFGDDYGIS VACEPDSYTRITLRLPWRDEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | btsS |
Synonyms | btsS; yehU; c2656; Sensor histidine kinase BtsS |
UniProt ID | P0AD15 |
◆ Recombinant Proteins | ||
NOC2L-1121Z | Recombinant Zebrafish NOC2L | +Inquiry |
LSR-8203H | Recombinant Human LSR protein, His & GST-tagged | +Inquiry |
IRF1-128H | Recombinant Human IRF1 protein, MYC/DDK-tagged | +Inquiry |
RFL29230CF | Recombinant Full Length Cricetulus Griseus Phosphatidylserine Synthase 2(Ptdss2) Protein, His-Tagged | +Inquiry |
EFNB3-5035M | Recombinant Mouse EFNB3 Protein | +Inquiry |
◆ Native Proteins | ||
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
Lectin-1716U | Native Ulex europaeus Lectin, Biotin conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJC1-294HCL | Recombinant Human GJC1 lysate | +Inquiry |
HEY2-5574HCL | Recombinant Human HEY2 293 Cell Lysate | +Inquiry |
PC-12-080RCL | Rat PC-12 Whole Cell Lysate | +Inquiry |
FCHO2-275HCL | Recombinant Human FCHO2 lysate | +Inquiry |
DBC1-2113HCL | Recombinant Human DBC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All btsS Products
Required fields are marked with *
My Review for All btsS Products
Required fields are marked with *
0
Inquiry Basket