Recombinant Full Length Probable Polyprenol Reductase(B0024.13) Protein, His-Tagged
Cat.No. : | RFL2593CF |
Product Overview : | Recombinant Full Length Probable polyprenol reductase(B0024.13) Protein (Q17428) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MLDRLWEVRQALPLYLLVSTLGLAISCCFTLICPHVCRLIPALTTYGKAADQQEDNSLVE KISVPKKWFKHFYAIGLLTLFICLHTVHSLIYNPNYLHPVVLKILATLTRSYSIPPITPS TSILALLLISLHVARRLYETIFVSVYSDSRMNLFHYAVGIVHYIILPISIMCETQGVASK LPQLHVSIDDISLTQWAGAVLFWICNWKQHQLAEQIANTRKGPRGLIRNYAYGICFGGWF NLVSCPHFLFEICIYLSLFLVIPDAYVYRFIIMFVCINQTFAALITHSWYHKTFPKYPKS RKALIPYVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B0024.13 |
Synonyms | B0024.13; Polyprenol reductase |
UniProt ID | Q17428 |
◆ Recombinant Proteins | ||
SPX-2026HF | Recombinant Full Length Human SPX Protein, GST-tagged | +Inquiry |
SSP-RS09875-0254S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS09875 protein, His-tagged | +Inquiry |
FAM171B-748H | Recombinant Human FAM171B Protein | +Inquiry |
Ttc9b-6717M | Recombinant Mouse Ttc9b Protein, Myc/DDK-tagged | +Inquiry |
IL12A & IL12B-1254H | Recombinant Human IL12A & IL12B Protein, His-Fc & Flag-Fc-tagged | +Inquiry |
◆ Native Proteins | ||
ACT-161R | Native rabbit ACT | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
IgG-011H | Native Human Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STOM-1393HCL | Recombinant Human STOM 293 Cell Lysate | +Inquiry |
ITPKC-884HCL | Recombinant Human ITPKC cell lysate | +Inquiry |
RSPH4A-570HCL | Recombinant Human RSPH4A lysate | +Inquiry |
MORF4L2-4251HCL | Recombinant Human MORF4L2 293 Cell Lysate | +Inquiry |
Skin-804G | Guinea Pig Skin Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B0024.13 Products
Required fields are marked with *
My Review for All B0024.13 Products
Required fields are marked with *
0
Inquiry Basket