Recombinant Full Length Human SPX Protein, GST-tagged

• Cat.No.: SPX-2026HF
• Product Overview: Human SPX full-length ORF (BAG51298.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 116 amino acids
• Description: The protein encoded by this gene is a hormone involved in modulation of cardiovascular and renal function. It has also been shown in rats to cause weight loss. Several transcript variants have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.7 kDa
• AA Sequence: MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPX spexin hormone [ Homo sapiens (human) ]
• Official Symbol: C12orf39
• Synonyms: C12orf39
• Gene ID: 80763
• mRNA Refseq: NM_030572.2
• Protein Refseq: NP_085049.1
• MIM: 619246
• UniProt ID: Q9BT56