Recombinant Full Length Human SPX Protein, GST-tagged

Cat.No. : SPX-2026HF
Product Overview : Human SPX full-length ORF (BAG51298.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 116 amino acids
Description : The protein encoded by this gene is a hormone involved in modulation of cardiovascular and renal function. It has also been shown in rats to cause weight loss. Several transcript variants have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.7 kDa
AA Sequence : MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPX spexin hormone [ Homo sapiens (human) ]
Official Symbol C12orf39
Synonyms C12orf39
Gene ID 80763
mRNA Refseq NM_030572.2
Protein Refseq NP_085049.1
MIM 619246
UniProt ID Q9BT56

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SPX Products

Required fields are marked with *

My Review for All SPX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon