Recombinant Full Length Probable Calcium-Binding Mitochondrial Carrier F17E5.2(F17E5.2) Protein, His-Tagged
Cat.No. : | RFL34658CF |
Product Overview : | Recombinant Full Length Probable calcium-binding mitochondrial carrier F17E5.2(F17E5.2) Protein (Q19529) (1-531aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-531) |
Form : | Lyophilized powder |
AA Sequence : | MSVTAESPSLRGGSILENKQELIDLKNIGEHARTVQPFKTSKHQPLIQGSVSKEAAIATH SALHFDLTPEKEKKIRDMYDRLDADNDGSIDIRDLTQALSLQAHIPASVAPKLLERMKSE HSDRVTYADFTNYVIAHEARLAEVFDKIDLNSDGEVDMAEIKSYCKEMGVNLDDQKAMSI VKKMDQSGSSSVNLNEFQDFMLLYPSTDMRDMVDFWRHNLIIDIGEDGQVPEDFTPQELL SGVWWRHLVAGGVAGAMSRTCTAPFDRIKVYLQVNSTKTNKLGVVSCVHLLHAEGGIKSF WRGNGINVIKIAPESAMKFMCYDQIKRWMQEYKGGAELSTIERLLAGSSAGAISQTAIYP MEVMKTRLALRRTGQLDKGMFHFAHKMYTKEGIKCFYKGYLPNLLGIIPYAGIDLTVYES LKSMYTKYYTEHTEPGVLALLACGTCSSTCGQLASYPLALVRTRLQARAISPKNSTQPDT MVGQFKHILQTEGFTGLYRGITPNFMKVIPAVSISYVVYEKVRKQLGATMT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | F17E5.2 |
Synonyms | F17E5.2; Probable calcium-binding mitochondrial carrier F17E5.2 |
UniProt ID | Q19529 |
◆ Recombinant Proteins | ||
TAT-01V | Recombinant HIV1 tat Protein | +Inquiry |
UBE2I-856H | Recombinant Human UBE2I protein(Met1-Ser158) | +Inquiry |
FTSJ3-1582R | Recombinant Rhesus Macaque FTSJ3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG4-7038M | Recombinant Mouse GNG4 Protein | +Inquiry |
FAM19A4-1289H | Recombinant Human FAM19A4 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
F13-53H | Active Native Human Coagulation Factor XIII, Alexa Fluor 700 Conjugated | +Inquiry |
BSI-B4-851 | Active Native Bandeiraea simplicifolia Isolectin B4 protein, biotin-conjugated | +Inquiry |
PLG-30083TH | Native Human PLG | +Inquiry |
ctxA-145V | Native Cholera Toxin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMF1-2737HCL | Recombinant Human PSMF1 293 Cell Lysate | +Inquiry |
SAP30-1559HCL | Recombinant Human SAP30 cell lysate | +Inquiry |
ZNF280C-1721HCL | Recombinant Human ZNF280C cell lysate | +Inquiry |
KLHL8-945HCL | Recombinant Human KLHL8 cell lysate | +Inquiry |
SUMO3-1343HCL | Recombinant Human SUMO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F17E5.2 Products
Required fields are marked with *
My Review for All F17E5.2 Products
Required fields are marked with *
0
Inquiry Basket