Recombinant HIV1 tat Protein
Cat.No. : | TAT-01V |
Product Overview : | Recombinant HIV1 tat Protein was expressed in E.coli. |
Availability | April 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HIV |
Source : | E.coli |
Description : | Tat |
Form : | 50mM Tris-HCl, 200 mM NaCl, pH 8.0. |
AA Sequence : | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFMTKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQSRGDPTGPKE |
Purity : | >95% as determined by SDS-PAGE. |
Storage : | Store it at 4 centigrade for short term. For long term storage, store it at -20 centigrade~-80 centigrade. |
Concentration : | 1.0 mg/ml |
Gene Name | tat Tat [ Human immunodeficiency virus 1 ] |
Official Symbol | tat |
Synonyms | HIV1gp5 |
Gene ID | 155871 |
Protein Refseq | NP_057853.1 |
UniProt ID | P04326 |
◆ Recombinant Proteins | ||
TAT-01V | Recombinant HIV1 tat Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIV1gp5 Products
Required fields are marked with *
My Review for All HIV1gp5 Products
Required fields are marked with *
0
Inquiry Basket