Recombinant HIV1 tat Protein
Cat.No. : | TAT-01V |
Product Overview : | Recombinant HIV1 tat Protein was expressed in E.coli. |
Availability | February 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HIV |
Source : | E.coli |
Description : | Tat |
Form : | 50mM Tris-HCl, 200 mM NaCl, pH 8.0. |
AA Sequence : | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFMTKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQSRGDPTGPKE |
Purity : | >95% as determined by SDS-PAGE. |
Storage : | Store it at 4 centigrade for short term. For long term storage, store it at -20 centigrade~-80 centigrade. |
Concentration : | 1.0 mg/ml |
Gene Name | tat Tat [ Human immunodeficiency virus 1 ] |
Official Symbol | tat |
Synonyms | HIV1gp5 |
Gene ID | 155871 |
Protein Refseq | NP_057853.1 |
UniProt ID | P04326 |
◆ Recombinant Proteins | ||
RFL3171AF | Recombinant Full Length Arabidopsis Thaliana Peroxisomal Membrane Protein 11B(Pex11B) Protein, His-Tagged | +Inquiry |
RFL14956HF | Recombinant Full Length Human Transmembrane Protein 185A(Tmem185A) Protein, His-Tagged | +Inquiry |
NR5A2-2505H | Recombinant Human NR5A2, His-tagged | +Inquiry |
GALNTL1-6192M | Recombinant Mouse GALNTL1 Protein | +Inquiry |
CD74-2229H | Recombinant Human CD74 | +Inquiry |
◆ Native Proteins | ||
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
LTF-229B | Native Bovine Lactoferrin | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB3IP-2595HCL | Recombinant Human RAB3IP 293 Cell Lysate | +Inquiry |
DZIP3-6744HCL | Recombinant Human DZIP3 293 Cell Lysate | +Inquiry |
CDADC1-7672HCL | Recombinant Human CDADC1 293 Cell Lysate | +Inquiry |
KCNK4-323HCL | Recombinant Human KCNK4 Lysate | +Inquiry |
C9orf102-7943HCL | Recombinant Human C9orf102 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIV1gp5 Products
Required fields are marked with *
My Review for All HIV1gp5 Products
Required fields are marked with *
0
Inquiry Basket