Recombinant Full Length Pongo Pygmaeus Olfactory Receptor 1D2(Or1D2) Protein, His-Tagged
Cat.No. : | RFL21875PF |
Product Overview : | Recombinant Full Length Pongo pygmaeus Olfactory receptor 1D2(OR1D2) Protein (Q9TU84) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Pygmaeus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSRLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQDKAISYAGCLTQLYFLLSLVTLDNLILAVMAY DRYVAICCPLHYVTAMSPRLCILLLSLCWVFSVLYGLIHTLLMTRVTFCGSRKIHYLFCE MYFLLRLACSNIQINHTVLXATGCFIFLIPLGFMIXSYARIVRAILRIPSATGKYKAFST CASHLAVVSLFYGTLGMVYLQPLQTYSTKDSVATVMYAVVTPMMNPFIYSLRNKDIHGAL GRLLQGKAFQKLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR1D2 |
Synonyms | OR1D2; Olfactory receptor 1D2 |
UniProt ID | Q9TU84 |
◆ Recombinant Proteins | ||
FOXP3-53H | Recombinant Human FOXP3 protein, His-tagged | +Inquiry |
CEP85-3846HF | Recombinant Full Length Human CEP85 Protein, GST-tagged | +Inquiry |
BCL2L2-1823D | Recombinant Dog BCL2L2 protein, His-tagged | +Inquiry |
MYL2-6759HF | Recombinant Full Length Human MYL2 Protein, GST-tagged | +Inquiry |
XCL2-002H | Active Recombinant Human XCL2, HIgG1 Fc-tagged, mutant | +Inquiry |
◆ Native Proteins | ||
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
FGG -47P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
F2-73R | Native Rat Prothrombin | +Inquiry |
Pepsin-41P | Active Native Porcine Pepsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCL-900MCL | Recombinant Mouse VCL cell lysate | +Inquiry |
TOM1L1-873HCL | Recombinant Human TOM1L1 293 Cell Lysate | +Inquiry |
MDA-MB-361-170H | MDA-MB-361 Whole Cell Lysate | +Inquiry |
RAMP1-2537HCL | Recombinant Human RAMP1 293 Cell Lysate | +Inquiry |
Stomach-578M | MiniPig Stomach Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR1D2 Products
Required fields are marked with *
My Review for All OR1D2 Products
Required fields are marked with *
0
Inquiry Basket