Recombinant Full Length Pan Troglodytes Olfactory Receptor 1D2(Or1D2) Protein, His-Tagged
Cat.No. : | RFL26563PF |
Product Overview : | Recombinant Full Length Pan troglodytes Olfactory receptor 1D2(OR1D2) Protein (Q9TUA8) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSCLHTPMY FFLANLSFTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVALDNLILAVMAY DRYVAICCPLHYTTAMSPKLCILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCE MYVLLRMACSNIQTNHTVLIATGCFIFLIPFGFVIISYVLIIRAILRIPSLSKKYKAFST CASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL GRLLDKHFKRLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR1D2 |
Synonyms | OR1D2; Olfactory receptor 1D2 |
UniProt ID | Q9TUA8 |
◆ Recombinant Proteins | ||
RPL4-1741C | Recombinant Chicken RPL4 | +Inquiry |
Cupa1-5816A | Recombinant Arizona cypress Cupa1 protein, His-tagged | +Inquiry |
HIP1R-4385H | Recombinant Human HIP1R Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAT-01V | Recombinant HIV1 tat Protein | +Inquiry |
YHCV-1845B | Recombinant Bacillus subtilis YHCV protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
L. pneumophila-26 | Native Legionella pneumophila Antigen | +Inquiry |
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
KRT19-40H | Native Human KRT19 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-275H | Human Kidney Tumor Lysate | +Inquiry |
TBXA2R-1197HCL | Recombinant Human TBXA2R 293 Cell Lysate | +Inquiry |
Gallbladder-193H | Human Gallbladder Liver Cirrhosis Lysate | +Inquiry |
IRF8-5159HCL | Recombinant Human IRF8 293 Cell Lysate | +Inquiry |
RHOC-2351HCL | Recombinant Human RHOC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR1D2 Products
Required fields are marked with *
My Review for All OR1D2 Products
Required fields are marked with *
0
Inquiry Basket