Recombinant Full Length Pongo Abelii Palmitoyltransferase Zdhhc5(Zdhhc5) Protein, His-Tagged
Cat.No. : | RFL34488PF |
Product Overview : | Recombinant Full Length Pongo abelii Palmitoyltransferase ZDHHC5(ZDHHC5) Protein (Q5R838) (1-715aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-715) |
Form : | Lyophilized powder |
AA Sequence : | MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLA NFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSG VRTADTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNV SRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSL EITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPTMYKYRPGYSS SSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDP LSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSP DFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHI VASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPL GRPAVPRFGKPDGLRGRGVGSPEPGPTAPYLGRSMSYSSQKAQPGVSETEEVALQPLLTP KDEVQLKTAYSKSNGQPKSLGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZDHHC5 |
Synonyms | ZDHHC5; Palmitoyltransferase ZDHHC5; Zinc finger DHHC domain-containing protein 5; DHHC-5 |
UniProt ID | Q5R838 |
◆ Recombinant Proteins | ||
RFL19304MF | Recombinant Full Length Mouse Lipid Phosphate Phosphatase-Related Protein Type 1(Lppr1) Protein, His-Tagged | +Inquiry |
STAR-4326R | Recombinant Rhesus Macaque STAR Protein, His (Fc)-Avi-tagged | +Inquiry |
CD27-1592H | Recombinant Human CD27 Molecule, Fc-His | +Inquiry |
CITED2-1582HFL | Recombinant Full Length Human CITED2 Protein, C-Flag-tagged | +Inquiry |
Tnfrsf12a-42M | Active Recombinant Mouse Fn-14, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
Chitosan-002C | Native Crawfish Chitosan | +Inquiry |
AGT-152H | Native Human Angiotensinogen | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEAF6-4397HCL | Recombinant Human MEAF6 293 Cell Lysate | +Inquiry |
CPB1-2423MCL | Recombinant Mouse CPB1 cell lysate | +Inquiry |
AIMP2-8951HCL | Recombinant Human AIMP2 293 Cell Lysate | +Inquiry |
KLF11-4932HCL | Recombinant Human KLF11 293 Cell Lysate | +Inquiry |
JAK3-5106HCL | Recombinant Human JAK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZDHHC5 Products
Required fields are marked with *
My Review for All ZDHHC5 Products
Required fields are marked with *
0
Inquiry Basket