Recombinant Human ZDHHC5 protein, His-tagged

• Cat.No.: ZDHHC5-7322H
• Product Overview: Recombinant Human ZDHHC5 protein(Q9C0B5)(60-148aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• ProteinLength: 60-148aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.6 kDa
• AASequence: ANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ZDHHC5 zinc finger, DHHC-type containing 5 [ Homo sapiens ]
• Official Symbol: ZDHHC5
• Synonyms: ZDHHC5; zinc finger, DHHC-type containing 5; palmitoyltransferase ZDHHC5; KIAA1748; ZNF375; DHHC-5; zinc finger protein 375; probable palmitoyltransferase ZDHHC5; zinc finger, DHHC domain containing 5; zinc finger DHHC domain-containing protein 5; membrane-associated DHHC5 zinc finger protein; DHHC5; DKFZp586K0524
• Gene ID: 25921
• mRNA Refseq: NM_015457
• Protein Refseq: NP_056272
• MIM: 614586
• UniProt ID: Q9C0B5