Recombinant Full Length Poly-Beta-1,6-N-Acetyl-D-Glucosamine Synthase(Icaa) Protein, His-Tagged
Cat.No. : | RFL36635SF |
Product Overview : | Recombinant Full Length Poly-beta-1,6-N-acetyl-D-glucosamine synthase(icaA) Protein (Q8GLC5) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MHIFNFLLFYPIFMSIYWIVGSIYYFFIKEKPFNRLLLVKSEHQQVEGISFLLACYNESE TVQDTLSSVLSLEYPEKEIIIINDGSSDNTAEIIYEFKKNHDFKFVDLEVNRGKANALNE GIKQASYEYVMCLDADTVIDDDAPFYMIEDFKKNPKLGAVTGNPRIRNKSSILGKIQTIE YASIIGCIKRSQSLAGAINTISGVFTLFKKSALKDVGYWDTDMITEDIAVSWKLHLFDYE IKYEPRALCWMLVPETIGGLWKQRVRWAQGGHEVLLRDFWSTIKTKKLSLYILMFEQIAS ITWVYIVICYLSFLVITANILDYTYLKYSFSIFFFSSFTMTFINIIQFTVALFIDSRYEK KNIVGLIFLSWYPTLYWVINAAVVIMAFPKALKRKKGGYATWSSPDRGNIQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | icaA |
Synonyms | icaA; Poly-beta-1,6-N-acetyl-D-glucosamine synthase; PNAG synthase; Poly-beta-1,6-GlcNAc synthase; Biofilm polysaccharide intercellular adhesin synthesis protein IcaA; Biofilm PIA synthesis protein IcaA; Intercellular adhesion protein A; N-acetylglucosami |
UniProt ID | Q8GLC5 |
◆ Recombinant Proteins | ||
MYH1E-2172C | Recombinant Chicken MYH1E | +Inquiry |
CTCFL-2044M | Recombinant Mouse CTCFL Protein, His (Fc)-Avi-tagged | +Inquiry |
BTG2-2532M | Recombinant Mouse BTG2 Protein | +Inquiry |
WDR82-21H | Recombinant Human WDR82 Protein, His-tagged | +Inquiry |
RFL11256NF | Recombinant Full Length Competence Protein Coma(Coma) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAU1-1415HCL | Recombinant Human STAU1 293 Cell Lysate | +Inquiry |
CACYBP-7899HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
TBX18-655HCL | Recombinant Human TBX18 lysate | +Inquiry |
RNF217-548HCL | Recombinant Human RNF217 lysate | +Inquiry |
IRF5-5162HCL | Recombinant Human IRF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All icaA Products
Required fields are marked with *
My Review for All icaA Products
Required fields are marked with *
0
Inquiry Basket