Recombinant Human WDR82 Protein, His-tagged

• Cat.No.: WDR82-21H
• Product Overview: Recombinant Human WDR82 Protein was expressed in E. coli with His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.
• Molecular Mass: 21 kDa
• AA Sequence: DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.

Gene Information

• Gene Name: WDR82 WD repeat domain 82 [ Homo sapiens (human) ]
• Official Symbol: WDR82
• Synonyms: SWD2; MST107; WDR82A; MSTP107; PRO2730; TMEM113; PRO34047
• Gene ID: 80335
• mRNA Refseq: NM_025222.3
• Protein Refseq: NP_079498.2
• MIM: 611059
• UniProt ID: Q6UXN9