Recombinant Human WDR82 Protein, His-tagged

Cat.No. : WDR82-21H
Product Overview : Recombinant Human WDR82 Protein was expressed in E. coli with His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.
Molecular Mass : 21 kDa
AA Sequence : DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Gene Name WDR82 WD repeat domain 82 [ Homo sapiens (human) ]
Official Symbol WDR82
Synonyms SWD2; MST107; WDR82A; MSTP107; PRO2730; TMEM113; PRO34047
Gene ID 80335
mRNA Refseq NM_025222.3
Protein Refseq NP_079498.2
MIM 611059
UniProt ID Q6UXN9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WDR82 Products

Required fields are marked with *

My Review for All WDR82 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon