Recombinant Human WDR82 Protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Form :	The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.
Molecular Mass :	21 kDa
AA Sequence :	DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
Storage :	Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.

Gene Name	WDR82 WD repeat domain 82 [ Homo sapiens (human) ]
Official Symbol	WDR82
Synonyms	SWD2; MST107; WDR82A; MSTP107; PRO2730; TMEM113; PRO34047
Gene ID	80335
mRNA Refseq	NM_025222.3
Protein Refseq	NP_079498.2
MIM	611059
UniProt ID	Q6UXN9

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry