Recombinant Full Length Pirellula Staleyi Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL32284PF |
Product Overview : | Recombinant Full Length Pirellula staleyi ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (D2QZ34) (1-700aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pirellula staleyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-700) |
Form : | Lyophilized powder |
AA Sequence : | MSSDNGSGRQGGDRGGSTGYNLLMYLGFGAIIATLVALYVLQMFQTSLDYTDLERLVAAS QYEKDESKLTAGSPGYIDVKVEARNTLRRMRVSNLRKVELGPTAVRGQIDLVELKPVGTS GDRWEPDSKTLRQNVEFRTNLSDKGSNRDDIETAIRNSNIPFRHADPPGPWEQHSQLIIG MLLAAMLIYIVVRRLSAAGSPMSFGRSRGKLYAQEELGITFNDVAGIDEAVEEVREVVDF LRSPEKYQKLGGRIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSDFVEMFVGVGA ARVRDMFQQAEAKAPCIIFIDELDALGKSRGAGIMGGHDEREQTLNALLVEMDGFGSNSG VIVMAATNRPETLDPALLRPGRFDRHVLVDRPDIKGREDILKVHVKNVKLDPTVDLHKVA AITPGFVGADLANLVNEAALLAARAEKTAVGMNEFNEGVERVTAGLEKKQRVMNEDEKLR VAYHESGHALVAYSLPNTDPVHKVSIIPRGLAALGYTMQRPEGDRFLMTQSELESRIQVL LAGTIAEEIIFTDISTGAQNDLERATDIARRMCMEFGMSRLGRVNYRESNRSAFLASGGS GEERVRSVSEQTLREIDQEVRRIIDESIEKVRHILDVRRGALVSLTNRLMEVESVDSDEL KRIIDETSPGPLVVPGTLPANTMRSTTEPVITAPATERSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Psta_3565; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | D2QZ34 |
◆ Recombinant Proteins | ||
KRTAP5-7-5827HF | Recombinant Full Length Human KRTAP5-7 Protein, GST-tagged | +Inquiry |
IL7R-5169H | Recombinant Human IL7R Protein | +Inquiry |
FGF8-92H | Active Recombinant Human/Mouse FGF8 Protein | +Inquiry |
RFL943BF | Recombinant Full Length Borrelia Burgdorferi Putative Zinc Metalloprotease Bb_0118 (Bb_0118) Protein, His-Tagged | +Inquiry |
TBL1X-99H | Recombinant Human TBL1X protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
Lectin-1749G | Active Native Galanthus Nivalis Lectin Protein | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPP7-4228HCL | Recombinant Human MPP7 293 Cell Lysate | +Inquiry |
STAT2-1419HCL | Recombinant Human STAT2 293 Cell Lysate | +Inquiry |
C11orf58-8341HCL | Recombinant Human C11orf58 293 Cell Lysate | +Inquiry |
ABR-9122HCL | Recombinant Human ABR 293 Cell Lysate | +Inquiry |
KCNJ5-5044HCL | Recombinant Human KCNJ5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket