Recombinant Full Length Borrelia Burgdorferi Putative Zinc Metalloprotease Bb_0118 (Bb_0118) Protein, His-Tagged
Cat.No. : | RFL943BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Putative zinc metalloprotease BB_0118 (BB_0118) Protein (O51145) (1-433aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-433) |
Form : | Lyophilized powder |
AA Sequence : | MYILFSVLALSFIIFIHELGHFLFAKLFKVKVEVFSVGIGPSILKFKINNTEYRLSPILL GGYCKLKGFDHLEKELKANKELEADKDSLFGISHFKKILIYFAGPLFNLIFSFIVFIFIS MAGVIYFDYSSRVSILNKDSLLKDKFRDGDVILKVNDKKIKYFSDLRKFIPEEKSTVMFD VLREKENITFKETVSLQDFLKEIGPWADLVIADVVSNSPAKIAGMKPGDEIISIDNVILK NKRDLDYFLKNLNSDVVEIKFSRNGEIFSSKLVFHDKNKMIGIYFSPPLKRVVKVENVSS AIKNSFFKVVSALQDILYSIFLLMTNFLNASKSVSGPVGIVGILSSSYSLGILYWINSIS FLSLILAGMNLFFIVIPIFDGGQIFISFIELLRGKRFKAKTIYSFYSFGIFFGLFLFGLG LFNDLKGLLNIFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BB_0118 |
Synonyms | BB_0118; Putative zinc metalloprotease BB_0118 |
UniProt ID | O51145 |
◆ Recombinant Proteins | ||
GAPDH-2941H | Recombinant Human GAPDH protein, His-SUMO-tagged | +Inquiry |
IGF2-620H | Recombinant Human IGF2 protein | +Inquiry |
ORC5-12408Z | Recombinant Zebrafish ORC5 | +Inquiry |
Chrna4-1964M | Recombinant Mouse Chrna4 protein, His & T7-tagged | +Inquiry |
CTRB1-1660R | Recombinant Rat CTRB1 Protein | +Inquiry |
◆ Native Proteins | ||
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NNMT-3779HCL | Recombinant Human NNMT 293 Cell Lysate | +Inquiry |
CCL15-7731HCL | Recombinant Human CCL15 293 Cell Lysate | +Inquiry |
RORA-2249HCL | Recombinant Human RORA 293 Cell Lysate | +Inquiry |
MARCH8-4469HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
ABCA3-2HCL | Recombinant Human ABCA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BB_0118 Products
Required fields are marked with *
My Review for All BB_0118 Products
Required fields are marked with *
0
Inquiry Basket