Recombinant Full Length Human KRTAP5-7 Protein, GST-tagged

• Cat.No.: KRTAP5-7-5827HF
• Product Overview: Human KRTAP5-7 full-length ORF ( AAI48791.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 165 amino acids
• Description: KRTAP5-7 (Keratin Associated Protein 5-7) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
• Molecular Mass: 45.1 kDa
• AA Sequence: MGCCGCSEGCGSGCGGCGSGCGGCGSGCGGCGSSCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSSCCNPCCSQSSCCVPVCCQCKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP5-7 keratin associated protein 5-7 [ Homo sapiens (human) ]
• Official Symbol: KRTAP5-7
• Synonyms: KRTAP5-7; keratin associated protein 5-7; KRTAP5-3; KRTAP5.7; keratin-associated protein 5-7; keratin-associated protein 5-3; keratin-associated protein 5.3; keratin-associated protein 5.7; ultrahigh sulfur keratin-associated protein 5.7
• Gene ID: 440050
• mRNA Refseq: NM_001012503
• Protein Refseq: NP_001012521
• UniProt ID: Q6L8G8