Recombinant Full Length Pig Small Conductance Calcium-Activated Potassium Channel Protein 3(Kcnn3) Protein, His-Tagged
Cat.No. : | RFL5078SF |
Product Overview : | Recombinant Full Length Pig Small conductance calcium-activated potassium channel protein 3(KCNN3) Protein (P58392) (1-724aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-724) |
Form : | Lyophilized powder |
AA Sequence : | MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQPPPPPPPPAPPAAPQQPPGPPLQPQP LQLQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQG SQLNLNDHLLGHSPSSTATSGPGGGGRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKP LSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIIISSREDNHAHQTLLHHPNATHNHQHAG TTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWG LYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYIS LEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSK LFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQ QDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLE LTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQA IHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLT ASFNSLPLLIADTLRQQQQQLLSALMEARGVSVAVGTTHTPLSDSPIGVSSTSFPTPYTS SSSC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNN3 |
Synonyms | KCNN3; Small conductance calcium-activated potassium channel protein 3; SK3; SKCa 3; SKCa3; KCa2.3 |
UniProt ID | P58392 |
◆ Recombinant Proteins | ||
TMUB2-1036C | Recombinant Cynomolgus TMUB2 Protein, His-tagged | +Inquiry |
RFL35198PF | Recombinant Full Length Pasteurella Multocida Electron Transport Complex Protein Rnfg(Rnfg) Protein, His-Tagged | +Inquiry |
KRT19-6567C | Recombinant Chicken KRT19 | +Inquiry |
GDF2-119H | Active Recombinant Human GDF2 Protein (Ser320-Arg429), N-His tagged, Animal-free, Carrier-free | +Inquiry |
FLT3LG-152H | Active Recombinant Human FLT3LG | +Inquiry |
◆ Native Proteins | ||
DEF-196H | Native Human Defensins | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
PGI-241H | Native Human Pepsinogen I | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf49-8348HCL | Recombinant Human C11orf49 293 Cell Lysate | +Inquiry |
SNAP25-1640HCL | Recombinant Human SNAP25 293 Cell Lysate | +Inquiry |
RAB11FIP5-2137HCL | Recombinant Human RAB11FIP5 cell lysate | +Inquiry |
C10orf46-197HCL | Recombinant Human C10orf46 cell lysate | +Inquiry |
STOM-1393HCL | Recombinant Human STOM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCNN3 Products
Required fields are marked with *
My Review for All KCNN3 Products
Required fields are marked with *
0
Inquiry Basket