Recombinant Full Length Pig L-Gulonolactone Oxidase(Gulo) Protein, His-Tagged
Cat.No. : | RFL12018SF |
Product Overview : | Recombinant Full Length Pig L-gulonolactone oxidase(GULO) Protein (Q8HXW0) (2-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-440) |
Form : | Lyophilized powder |
AA Sequence : | VHGHKGVKFQNWAKTYGCCPEMYYQPTSVEEIREVLALARQQNKRVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLKVDMEKKQVTVEAGILLADLHPQLDKHGLALSNLGAVSDVTAGGV IGSGTHNTGIKHGILATQVVELTLLTPDGTVLVCSESSNAEVFQAARVHLGCLGVILTVT LQCVPQFHLQETTFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSVIYQDHTNKPPSS SANWFWDYAIGFYLLEFLLWISTFVPGLVGWINRFFFWLLFNGKKENCNLSHKIFTYECR FKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRADDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKVGGRPHWAKAHNCTRKDFEKMYPAFRKFCAIR EKLDPTGMFLNAYLEKVFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GULO |
Synonyms | GULO; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO |
UniProt ID | Q8HXW0 |
◆ Recombinant Proteins | ||
KLK1B22-4871M | Recombinant Mouse KLK1B22 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTTN-27H | Recombinant Human CTTN, GST-tagged | +Inquiry |
CCBP2-2805M | Recombinant Mouse CCBP2 Protein | +Inquiry |
GSX1-2007Z | Recombinant Zebrafish GSX1 | +Inquiry |
Cdhr2-2082M | Recombinant Mouse Cdhr2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
NTF3-29249TH | Native Human NTF3 | +Inquiry |
IgG-333T | Native Turkey IgG | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
PAIP1-3460HCL | Recombinant Human PAIP1 293 Cell Lysate | +Inquiry |
AMTN-001HCL | Recombinant Human AMTN cell lysate | +Inquiry |
CSTF3-7222HCL | Recombinant Human CSTF3 293 Cell Lysate | +Inquiry |
SUZ12-1330HCL | Recombinant Human SUZ12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GULO Products
Required fields are marked with *
My Review for All GULO Products
Required fields are marked with *
0
Inquiry Basket