Recombinant Full Length Mouse L-Gulonolactone Oxidase(Gulo) Protein, His-Tagged
Cat.No. : | RFL24620MF |
Product Overview : | Recombinant Full Length Mouse L-gulonolactone oxidase(Gulo) Protein (P58710) (2-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-440) |
Form : | Lyophilized powder |
AA Sequence : | VHGYKGVQFQNWAKTYGCSPEMYYQPTSVGEVREVLALARQQNKKVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLQVDKEKKQVTVEAGILLTDLHPQLDKHGLALSNLGAVSDVTVGGV IGSGTHNTGIKHGILATQVVALTLMKADGTVLECSESSNADVFQAARVHLGCLGVILTVT LQCVPQFHLLETSFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSIIYQDHTNKEPSS ASNWFWDYAIGFYLLEFLLWTSTYLPRLVGWINRFFFWLLFNCKKESSNLSHKIFSYECR FKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRGDDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHNCTRKDFEKMYPAFHKFCDIR EKLDPTGMFLNSYLEKVFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gulo |
Synonyms | Gulo; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO |
UniProt ID | P58710 |
◆ Recombinant Proteins | ||
DTX3-2907H | Recombinant Human DTX3 Protein, GST-tagged | +Inquiry |
EIF2AK2-563H | Recombinant Human EIF2AK2 protein, His-tagged | +Inquiry |
BTLA-2828H | Recombinant Human BTLA Protein, MYC/DDK-tagged | +Inquiry |
ASB18-776M | Recombinant Mouse ASB18 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADH8A-266Z | Recombinant Zebrafish ADH8A | +Inquiry |
◆ Native Proteins | ||
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
CTSB-5328H | Native Human Cathepsin B | +Inquiry |
Plg-291M | Active Native Mouse glu-Plasminogen | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPLA-2689HCL | Recombinant Human PTPLA 293 Cell Lysate | +Inquiry |
PLA2G4C-3140HCL | Recombinant Human PLA2G4C 293 Cell Lysate | +Inquiry |
HOOK1-5435HCL | Recombinant Human HOOK1 293 Cell Lysate | +Inquiry |
PPP5C-2908HCL | Recombinant Human PPP5C 293 Cell Lysate | +Inquiry |
ARL2BP-8715HCL | Recombinant Human ARL2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gulo Products
Required fields are marked with *
My Review for All Gulo Products
Required fields are marked with *
0
Inquiry Basket