Recombinant Full Length Photosystem Q(B) Protein(Psba1) Protein, His-Tagged
Cat.No. : | RFL35183OF |
Product Overview : | Recombinant Full Length Photosystem Q(B) protein(psbA1) Protein (Q0P3J1) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ostreococcus tauri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MTATLERRANATVWGRFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIVAFIAAPPVDI DGIREPVSGSLMYGNNIISGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFF IGICSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAIWPVMGIWFTALGISTMAFNLNGF NFNQSVVDSNGRVINTWADIVNRANLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA1 |
Synonyms | psbA1; OtCpg00300; psbA2; OtCpg00610; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein |
UniProt ID | Q0P3J1 |
◆ Recombinant Proteins | ||
ERBB2-4385HF | Recombinant Full Length Human ERBB2 Protein, GST-tagged | +Inquiry |
PFDN6-1656H | Recombinant Human PFDN6, GST-tagged | +Inquiry |
LRRK2-115H | Active Recombinant Human LRRK2 (Y1699C) Protein, GST-tagged | +Inquiry |
CDIPT-11817Z | Recombinant Zebrafish CDIPT | +Inquiry |
COMMD10-3091C | Recombinant Chicken COMMD10 | +Inquiry |
◆ Native Proteins | ||
UBA52-140H | Native Bovine Ubiquitin, Biotinylated | +Inquiry |
CPB-01P | Native Porcine Carboxypeptidase B | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-676H | Hamster Stomach Lysate, Total Protein | +Inquiry |
TNIP3-887HCL | Recombinant Human TNIP3 293 Cell Lysate | +Inquiry |
SGTA-1882HCL | Recombinant Human SGTA 293 Cell Lysate | +Inquiry |
NCAPH-3954HCL | Recombinant Human NCAPH 293 Cell Lysate | +Inquiry |
CYP4V2-440HCL | Recombinant Human CYP4V2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbA1 Products
Required fields are marked with *
My Review for All psbA1 Products
Required fields are marked with *
0
Inquiry Basket