Recombinant Full Length Prochlorococcus Marinus Photosystem Q(B) Protein(Psba1) Protein, His-Tagged
Cat.No. : | RFL1954PF |
Product Overview : | Recombinant Full Length Prochlorococcus marinus Photosystem Q(B) protein(psbA1) Protein (Q46JV2) (1-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorococcus marinus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-345) |
Form : | Lyophilized powder |
AA Sequence : | MTTIQQQRSSLLKGWPQFCEWVTSTNNRIYVGWFGVLMIPCLLAATTCFIVAFIAAPPVD IDGIREPVAGSFMYGNNIISGAVVPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLVIFHF LIGISAYMGRQWELSYRLGMRPWICVAYSAPVSAAFAVFLVYPFGQGSFSDGMPLGISGT FNFMFVFQAEHNILMHPFHMAGVAGMFGGALFSAMHGSLVTSSLIRETTGLDSQNYGYKF GQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLASWPVICVWLTSMGICTMAFNLNG FNFNQSVVDTSGKVVPTWGDVLNRANLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA1 |
Synonyms | psbA1; PMN2A_0558; psbA2; PMN2A_0735; psbA3; PMN2A_1592; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein |
UniProt ID | Q46JV2 |
◆ Native Proteins | ||
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
IgGF-330C | Native Chicken IgG Fab | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-784D | Dog Liver Membrane Lysate, Total Protein | +Inquiry |
ETFA-6532HCL | Recombinant Human ETFA 293 Cell Lysate | +Inquiry |
RPL13-2225HCL | Recombinant Human RPL13 293 Cell Lysate | +Inquiry |
Adrenal-11C | Cynomolgus monkey Adrenal Lysate | +Inquiry |
SEC14L1-1999HCL | Recombinant Human SEC14L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbA1 Products
Required fields are marked with *
My Review for All psbA1 Products
Required fields are marked with *
0
Inquiry Basket