Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL23810MF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q9MUV7) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mesostigma viride (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLISVHIMHTGLVSGWAGSMAFYELAVFDPSDPVLNPMWRQGM FVLPFMTRLGISKSWGGWDINGDSITDPGLWSYEGVAATHIILAGLMFLASMWHWVYWDL ELFRDPRTGKPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDPYGITGRVQP IEPSWGADGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPSFRLYKALRMGNVETVLSS SIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDLGYFNKEINKRVQASIASGSTASE AWSRIPEKLAFYDYIGNNPAKGGLFRAGAMNNGDGIAAGWLGHAVFKDKEGRELFVRRMP TFFETFPVVLLDKDGIVRADIPFRRAESKYSIEQVGVSVAFYGGELDGVTFKDPTTVKKY ARRAQLGEIFEFDRARLKSDGVFRSSPRGWFTFGHLCFALLFFFGHIWHGARTIFRDVFA GIDPDLDEQVEFGAFQKLGDASTRKQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q9MUV7 |
◆ Recombinant Proteins | ||
ENOX2-186H | Recombinant Human ENOX2 protein, GST-tagged | +Inquiry |
Amt-1617M | Recombinant Mouse Amt Protein, Myc/DDK-tagged | +Inquiry |
NCF4-465H | Recombinant Human NCF4 Protein, His-tagged | +Inquiry |
HA-214H | Recombinant Influenza A H5N1 (A/Vietnam/1194/2004) HA Protein, His-tagged | +Inquiry |
Angptl7-555M | Active Recombinant Mouse Angiopoietin-Like 7, His-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
Complement C1q-43H | Native Human Complement C1q | +Inquiry |
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
Serpinc1-5483R | Native Rat Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
F10-302R | Native Rat Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-319R | Rabbit Lung Lysate | +Inquiry |
TMPRSS3-909HCL | Recombinant Human TMPRSS3 293 Cell Lysate | +Inquiry |
CASC4-7843HCL | Recombinant Human CASC4 293 Cell Lysate | +Inquiry |
ZZZ3-9177HCL | Recombinant Human ZZZ3 293 Cell Lysate | +Inquiry |
GALP-6029HCL | Recombinant Human GALP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket