Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL17687AF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q70XY1) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Amborella trichopoda |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLASIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENLSLSE AWSKIPDKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNRVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKIGDPTTRRQIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q70XY1 |
◆ Recombinant Proteins | ||
Lcn5-9009M | Recombinant Mouse Lcn5 protein, Full length, His-tagged | +Inquiry |
ALC-6010C | Recombinant Chicken ALC | +Inquiry |
AYP1020-RS05740-4959S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS05740 protein, His-tagged | +Inquiry |
NUP93-509H | Recombinant Human NUP93 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FAP-3281H | Recombinant Human FAP Protein (Ile523-Asp760), His tagged | +Inquiry |
◆ Native Proteins | ||
VLDL-252H | Native Human Very Low Density Lipoprotein | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOC541469-4681HCL | Recombinant Human LOC541469 293 Cell Lysate | +Inquiry |
Spinal cord-464C | Cynomolgus monkey Spinal cord Membrane Lysate | +Inquiry |
DHRS7B-6935HCL | Recombinant Human DHRS7B 293 Cell Lysate | +Inquiry |
MCAT-4431HCL | Recombinant Human MCAT 293 Cell Lysate | +Inquiry |
PLA2G12A-482HCL | Recombinant Human PLA2G12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket