Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL29536PF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q1XDG4) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyropia yezoensis (Susabi-nori) (Porphyra yezoensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGM FVMPFMARLGVTDSWGGWSITGESVSNPGLWSFEGVALTHIVLSGMLFLAAIWHWVYWDL ELFRDPRTGEPALDLPKIFGIHLLLSSLLCFGFGAFHVTGLFGPGMWVSDGYGVTGKVLP VAPAWGPEGFNPFNPGGVASHHIAAGTVGILAGVFHLTVRPPQRLYRALRMGNIETVLSS SISAVFFSAFVTCGTMWYGSATTPIELFGPTRYQWDSGYFQQEIEKRVENAIADGAAPSE AWSRIPDKLAFYDYIGNNPAKGGLFRAGPMNKGDGVAEAWLGHPVFQDKEGRELSVRRMP AFFETFPVILVDKDGIIRADIPFRRAESKYSIEQVGVTASFYGGKLNGQVFNDAPSVKKY ARKAQLGEVFEFDRTTLESDGVFRSSPRGWFTFGHANFALIFFFGHLWHGSRTIFRDVFA GIGAEVTEQVEFGAFQKLGDRSSKKQGAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q1XDG4 |
◆ Recombinant Proteins | ||
GGCX-29018TH | Recombinant Human GGCX | +Inquiry |
RFL12614SF | Recombinant Full Length Staphylococcus Aureus Na(+)/H(+) Antiporter Subunit B1(Mnhb1) Protein, His-Tagged | +Inquiry |
EPAS1-12475H | Recombinant Human EPAS1, GST-tagged | +Inquiry |
DUSP12-3080Z | Recombinant Zebrafish DUSP12 | +Inquiry |
GPC3-765H | Active Recombinant Human GPC3 Transmembrane protein(VLPs) | +Inquiry |
◆ Native Proteins | ||
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA8-1012HCL | Recombinant Human IFNA8 Overexpression Lysate(Met1-Glu189) | +Inquiry |
CTSL2-7191HCL | Recombinant Human CTSL2 293 Cell Lysate | +Inquiry |
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
SPON2-1503HCL | Recombinant Human SPON2 293 Cell Lysate | +Inquiry |
CPEB4-7314HCL | Recombinant Human CPEB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket