Recombinant Full Length Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL35968PF |
Product Overview : | Recombinant Full Length Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (P27200) (1-514aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorothrix hollandica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-514) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTAVINDPGRLLAVHLMHTALVLGWAGSMALYELAVFDPSDAVLNPMWRQGM FVLPFMTRLGVTHSWSGWTVTGEPWINEPGFLNAHFNFWSYEGVALMHIVLSGLFFLAAV WHWVYWDLDLFEDPRTGEPALDLPKIFGGHLFLLGFLCFNFGTFHLTGIFGPGMWVSDAY GLTGHIEHIAPEWGPAGFNPFNPGGVVAHHIAAGITLMIGGVFHLTARPPERLYTALRMG NVETALASAIAAVFGAAFVVAGTMWYGHVTTPIELFGPTRYQWDQGYFTQEIQRRVDSQL AEGASLSEAWSSIPEKLAFYDYVGNSPAKGGLFRVGAMDSGDGIAEEWLGHPVFQDGAGR ALSVRRLPNFFENFPVILTDGDGVVRADIPFRRSESQYSFEQTGVTVSFYGGALDGQTFT NPSDVKKFARRAQLGEAFDFDTETLGSDGVFRTSTRGWFTFGHACFALLFFFGHIWHGAR TLFRDVFAGIDADLGEQIEFGAFQKLGDLTTRKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | P27200 |
◆ Recombinant Proteins | ||
PPIB-265C | Recombinant Chicken PPIB Protein, His-tagged | +Inquiry |
ABHD5-580HFL | Recombinant Full Length Human ABHD5 Protein, C-Flag-tagged | +Inquiry |
SEPF-928C | Recombinant CUTAK SEPF protein, His-tagged | +Inquiry |
Bhmt-709M | Recombinant Mouse Bhmt Protein, MYC/DDK-tagged | +Inquiry |
RFL25337BF | Recombinant Full Length Bacillus Weihenstephanensis Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS7-2369HCL | Recombinant Human RGS7 293 Cell Lysate | +Inquiry |
RAB3C-2598HCL | Recombinant Human RAB3C 293 Cell Lysate | +Inquiry |
ESRP2-6537HCL | Recombinant Human ESRP2 293 Cell Lysate | +Inquiry |
KCNAB1-5075HCL | Recombinant Human KCNAB1 293 Cell Lysate | +Inquiry |
ISLR-5148HCL | Recombinant Human ISLR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket