Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL20377CF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q8M9W5) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chaetosphaeridium globosum (Charophycean green alga) (Herposteiron globosum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLSVGGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLASLGWGVGPGGEVIDTFPYFVSGVLHVISSAVLGFGGVYHAI IGPETLEESFPFFGYVWKDKNKMTTILGIHLVLLGFGALLLVAKAVWFGGVYDTWAPGGG DVRVITNPTYDPSIIFGYLLKSPFGGEGWITSVDNMEDIIGGHIWIGFICIFGGIWHIVT KPFAWARRAFVWSGEAYLSYSLGAISAMGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANIGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNG LDLSKLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLG FFFFVAHLWHAGRARAAAAGFEKGIERETEPVLFMSPLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q8M9W5 |
◆ Recombinant Proteins | ||
RIBC-0477B | Recombinant Bacillus subtilis RIBC protein, His-tagged | +Inquiry |
EIF4E-41H | Recombinant Human EIF4E Protein Complexed With m7GTP (1-217) | +Inquiry |
Fgfr2-501M | Recombinant Mouse Fgfr2 protein(Met1-Glu263), hFc-tagged | +Inquiry |
FOXD3-144H | Recombinant Human FOXD3 protein, Arginine-tagged | +Inquiry |
GYS1-910H | Recombinant Human GYS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOL2-8777HCL | Recombinant Human APOL2 293 Cell Lysate | +Inquiry |
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
RIOK3-1512HCL | Recombinant Human RIOK3 cell lysate | +Inquiry |
BLVRB-8440HCL | Recombinant Human BLVRB 293 Cell Lysate | +Inquiry |
SEPT7-1953HCL | Recombinant Human SEPT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket