Recombinant Full Length Gnetum Parvifolium Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL5665GF |
Product Overview : | Recombinant Full Length Gnetum parvifolium Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (A6BM30) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gnetum parvifolium (Small-leaved jointfir) (Gnetum scandens var. parvifolium) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLTLAGRDQETTGFAWWAGNARLINLSGKLLGAHVSHAGLIVFWAGSMNLFEVAH FIPEKPMYEQGLILLPHLATLGWGVGPGGEIVDTFPYFVSGVLHLISSAVLGFGGIYHAL IGPETLEESFPFFGYTWKDRNKMTTILGIHLILLGAGAFLLVFKALFFGGIYDTWAPGGG DVRKITNLTLSPNIIFGYLLKSPFGGEGWIVSVDNLEDLIGGHFWLGSICIFGGIWHILT KPFAWTRRAFVWSGEAYLSYSLGALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGASVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNG LDLSKLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDLEPVLFMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | A6BM30 |
◆ Recombinant Proteins | ||
TMPRSS2-4594H | Recombinant Human TMPRSS2 protein, GST-tagged | +Inquiry |
STARD4-3575C | Recombinant Chicken STARD4 | +Inquiry |
NI36-RS02725-0905S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS02725 protein, His-tagged | +Inquiry |
ATP6V1D-2163M | Recombinant Mouse ATP6V1D Protein | +Inquiry |
PRSS8-30709TH | Recombinant Full Length Human PRSS8 Protein, GST tagged | +Inquiry |
◆ Native Proteins | ||
TnI-1050H | Native Human Cardiac Troponin I | +Inquiry |
F9-266B | Active Native Bovine Factor IX | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
SERPING1-73H | Native Human C1 Esterase inhibitor | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFP90-1978HCL | Recombinant Human ZFP90 cell lysate | +Inquiry |
CAMLG-7872HCL | Recombinant Human CAMLG 293 Cell Lysate | +Inquiry |
SMA4-1643HCL | Recombinant Human SMA4 cell lysate | +Inquiry |
ENC1-6603HCL | Recombinant Human ENC1 293 Cell Lysate | +Inquiry |
THY1-1297RCL | Recombinant Rat THY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket