Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL5827LF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q9BBT1) (3-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lotus japonicus (Lotus corniculatus var. japonicus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (3-461) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALTGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKASYFGGIYDTWAPGGG DVRKITNLTLSPSIIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRALVWSGEAYLSYSLAALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q9BBT1 |
◆ Recombinant Proteins | ||
CPEB3-3839M | Recombinant Mouse CPEB3 Protein | +Inquiry |
DBN1-1781R | Recombinant Rat DBN1 Protein | +Inquiry |
GSTT2-2665H | Recombinant Human GSTT2 protein, His & T7-tagged | +Inquiry |
Rab43-5323M | Recombinant Mouse Rab43 Protein, Myc/DDK-tagged | +Inquiry |
CNTN4-11412H | Recombinant Human CNTN4, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-405H | Native Human Low Density Lipoprotein, Acetylated | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMAIP1-3090HCL | Recombinant Human PMAIP1 293 Cell Lysate | +Inquiry |
PCSK1-2249HCL | Recombinant Human PCSK1 cell lysate | +Inquiry |
TDO2-1156HCL | Recombinant Human TDO2 293 Cell Lysate | +Inquiry |
BCAP29-161HCL | Recombinant Human BCAP29 cell lysate | +Inquiry |
TLR6-1044HCL | Recombinant Human TLR6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket