Recombinant Full Length Phaffia Rhodozyma Bifunctional Lycopene Cyclase/Phytoene Synthase(Crtyb) Protein, His-Tagged
Cat.No. : | RFL10058PF |
Product Overview : | Recombinant Full Length Phaffia rhodozyma Bifunctional lycopene cyclase/phytoene synthase(crtYB) Protein (Q7Z859) (1-673aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-673) |
Form : | Lyophilized powder |
AA Sequence : | MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILVFIAFSATTPWDSWIIRNGA WTYPSAESGQGVFGTFLDVPYEEYAFFVIQTVITGLVYVLATRHLLPSLALPKTRSSALS LALKALIPLPIIYLFTAHPSPSPDPLVTDHYFYMRALSLLITPPTMLLAALSGEYAFDWK SGRAKSTIAAIMIPTVYLIWVDYVAVGQDSWSINDEKIVGWRLGGVLPIEEAMFFLLTNL MIVLGLSACDHTQALYLLHGRTIYGNKKMPSSFPLITPPVLSLFFSSRPYSSQPKRDLEL AVKLLEEKSRSFFVASAGFPSEVRERLVGLYAFCRVTDDLIDSPEVSSNPHATIDMVSDF LTLLFGPPLHPSQPDKILSSPLLPPSHPSRPTGMYPLPPPPSLSPAELVQFLTERVPVQY HFAFRLLAKLQGLIPRYPLDELLRGYTTDLIFPLSTEAVQARKTPIETTADLLDYGLCVA GSVAELLVYVSWASAPSQVPATIEEREAVLVASREMGTALQLVNIARDIKGDATEGRFYL PLSFFGLRDESKLAIPTDWTEPRPQDFDKLLSLSPSSTLPSSNASESFRFEWKTYSLPLV AYAEDLAKHSYKGIDRLPTEVQAGMRAACASYLLIGREIKVVWKGDVGERRTVAGWRRVR KVLSVVMSGWEGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtYB |
Synonyms | crtYB; pbs; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | Q7Z859 |
◆ Recombinant Proteins | ||
RFL27763MF | Recombinant Full Length Monodelphis Domestica Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
TARDBP-35H | Recombinant Human TARDBP, MYC/DDK-tagged | +Inquiry |
PLA2G2A-4488R | Recombinant Rat PLA2G2A Protein | +Inquiry |
ACBD6-1174M | Recombinant Mouse ACBD6 Protein | +Inquiry |
HPV39-014H | Active Recombinant HPV 39 L1 protein | +Inquiry |
◆ Native Proteins | ||
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
Lectin-1807M | Active Native Maackia Amurensis Lectin I Protein, Biotinylated | +Inquiry |
PLG-8H | Native Human Plasminogen, FITC Labeled | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMSB4X-904HCL | Recombinant Human TMSB4X 293 Cell Lysate | +Inquiry |
TFAP4-1137HCL | Recombinant Human TFAP4 293 Cell Lysate | +Inquiry |
ABO-9124HCL | Recombinant Human ABO 293 Cell Lysate | +Inquiry |
TRIM21-791HCL | Recombinant Human TRIM21 293 Cell Lysate | +Inquiry |
KCNMB3-5023HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All crtYB Products
Required fields are marked with *
My Review for All crtYB Products
Required fields are marked with *
0
Inquiry Basket