Recombinant Full Length Leptotrichia Buccalis Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL9127LF |
Product Overview : | Recombinant Full Length Leptotrichia buccalis Protein translocase subunit SecD(secD) Protein (C7NC37) (1-404aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leptotrichia buccalis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-404) |
Form : | Lyophilized powder |
AA Sequence : | MQNKKSHYIWLFLVIFVPALILYFNKVKLGLDLRGGTSVVLQAQGKIEADTMSKVRNIIE RRVNSIGVAEPVIQLSGNDKLIVELAGIKDPQKAIELIGTTAKLEFRIKNKDGSYGPVLL EGSALKSAGVSRDQVGMPSVSFELNSQGANTFAKITRENIGKQLAIMLDNKEQSAPTINS EINGGSGIITGRFSMEEANNLANLLKSGALPVEIKIVENRTVGATLGVDSIKQTGIAGLI ALGVISVFMIAIYKIPGIVADIALLINGVLVLGLLSGIGAALTLPGIAGFILTLGMAVDS NVITYERIKEELRLGESLHDAVERGYENAFPAIIDGNITTLLVAAVLFFLGTGPIKGFAV TLSLGVVATIITGVFVSKVILKLFIKTFNIKREQLFWKGALNED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; Lebu_1853; Protein translocase subunit SecD |
UniProt ID | C7NC37 |
◆ Recombinant Proteins | ||
CRY24 | Recombinant Mouse Cytochrome c, Testis-specific | +Inquiry |
LAMA1-3340H | Recombinant Human LAMA1 protein, His-GST-tagged | +Inquiry |
HIST1H1A-1906R | Recombinant Rhesus Macaque HIST1H1A Protein, His (Fc)-Avi-tagged | +Inquiry |
NT3-205H | Active Recombinant Human NT3 protein(Tyr139-Thr257) | +Inquiry |
RALB-255H | Recombinant Human RALB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
Fgb -68R | Native Rat Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNL3-5846HCL | Recombinant Human GNL3 293 Cell Lysate | +Inquiry |
ANKRD22-23HCL | Recombinant Human ANKRD22 lysate | +Inquiry |
PPP2R5C-2917HCL | Recombinant Human PPP2R5C 293 Cell Lysate | +Inquiry |
KIF11-4956HCL | Recombinant Human KIF11 293 Cell Lysate | +Inquiry |
Jejunum-674H | Hamster Jejunum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket