Recombinant Full Length Parabacteroides Distasonis Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL2638PF |
Product Overview : | Recombinant Full Length Parabacteroides distasonis ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (A6LD25) (1-684aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Parabacteroides distasonis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-684) |
Form : | Lyophilized powder |
AA Sequence : | MENKNDMFNKTPKSGKPKMFRFNLYWMYGLIFIMLVALYMTNDSSGTKELGWTEFQKLAQ ENVFDKMTVYNKKNLVEATVKNGKTEQVFGNMDVSKIGVSPKVYVKIPSADKFSDFYDKA VADSHIDTQVRFEEGDDAIWNFLVSFGPIILLIGVWMFLMRRMSGGTGAGPGGVFSVGKA KAQLFDKDNDRKVTFKDVAGLAEAKQEVEEIVSFLKNPEKYTELGGKIPKGALLVGPPGT GKTLLAKAVAGEANVPFFSLSGSDFVEMFVGVGASRVRDLFRQAKEKSPCIVFIDEIDAV GRARGKNANMNSNDERENTLNQLLTEMDGFGSNSGVIILAATNRADILDKALLRAGRFDR QIHVELPDLNERKEIFGVHLRPIKIDESVDAEFLARQTPGFSGADIANVCNEAALIAARN GKKFVQKEDFMNAVDRIVGGLEKRSKITTEEERKCIANHEAGHATLSWLLEHANPLVKVT IVPRGKALGAAWYLPEERQITTREQLQDEMCATLGGRAAEELVLGKISTGASNDLERVTK QAYAMVVYFGMSDKLPNLNYYDSTGQDWGFTKPYSEETAKLIDTEVQKIINEQYDRAKRI LSENKEGHSKLAQVLLDREVIYSEDVEHIFGKRAWISRSQEILELQEKANGKNKENADKE AEADATTENVTDTPTEENKTGKIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; BDI_1854; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | A6LD25 |
◆ Recombinant Proteins | ||
Dnajb2-2598M | Recombinant Mouse Dnajb2 Protein, Myc/DDK-tagged | +Inquiry |
ZBED4-5303Z | Recombinant Zebrafish ZBED4 | +Inquiry |
MND1-5216HF | Recombinant Full Length Human MND1 Protein, GST-tagged | +Inquiry |
CD70-330M | Recombinant Mouse CD70 protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
SHISA2-4195R | Recombinant Rhesus monkey SHISA2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KLK4-238H | Native Human Kallikrein | +Inquiry |
F10-355H | Native Human Coagulation factor X, APC conjugated | +Inquiry |
COL1-119H | Native Human COL1 protein, Biotinylated | +Inquiry |
FABP-174M | Native Cynomolgus Monkey Fatty acid Binding Protein | +Inquiry |
Avidin-155C | Active Native Chicken Egg White Avidin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCTL-4793HCL | Recombinant Human LCTL 293 Cell Lysate | +Inquiry |
KCNJ4-5045HCL | Recombinant Human KCNJ4 293 Cell Lysate | +Inquiry |
ARL16-8717HCL | Recombinant Human ARL16 293 Cell Lysate | +Inquiry |
POLD1-3053HCL | Recombinant Human POLD1 293 Cell Lysate | +Inquiry |
Duodenum-472C | Cat Duodenum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket