Recombinant Full Length Human MND1 Protein, GST-tagged

Cat.No. : MND1-5216HF
Product Overview : Human GAJ full-length ORF ( AAH32142, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.[supplied by OMIM
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 48.29 kDa
Protein length : 205 amino acids
AA Sequence : MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MND1 meiotic nuclear divisions 1 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol MND1
Synonyms MND1; meiotic nuclear divisions 1 homolog (S. cerevisiae); meiotic nuclear division protein 1 homolog; GAJ; homolog of yeast MND1;
Gene ID 84057
mRNA Refseq NM_001253861
Protein Refseq NP_001240790
MIM 611422
UniProt ID Q9BWT6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MND1 Products

Required fields are marked with *

My Review for All MND1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon