Description :	The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.[supplied by OMIM
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	48.29 kDa
Protein length :	205 amino acids
AA Sequence :	MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	MND1 meiotic nuclear divisions 1 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol	MND1
Synonyms	MND1; meiotic nuclear divisions 1 homolog (S. cerevisiae); meiotic nuclear division protein 1 homolog; GAJ; homolog of yeast MND1;
Gene ID	84057
mRNA Refseq	NM_001253861
Protein Refseq	NP_001240790
MIM	611422
UniProt ID	Q9BWT6