Recombinant Full Length Human MND1 Protein, GST-tagged
Cat.No. : | MND1-5216HF |
Product Overview : | Human GAJ full-length ORF ( AAH32142, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 205 amino acids |
Description : | The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 and HOP2 genes are indispensable for meiotic recombination.[supplied by OMIM |
Molecular Mass : | 48.29 kDa |
AA Sequence : | MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MND1 meiotic nuclear divisions 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MND1 |
Synonyms | MND1; meiotic nuclear divisions 1 homolog (S. cerevisiae); meiotic nuclear division protein 1 homolog; GAJ; homolog of yeast MND1; |
Gene ID | 84057 |
mRNA Refseq | NM_001253861 |
Protein Refseq | NP_001240790 |
MIM | 611422 |
UniProt ID | Q9BWT6 |
◆ Recombinant Proteins | ||
MND1-923H | Recombinant Human MND1, GST-tagged | +Inquiry |
MND1-5612M | Recombinant Mouse MND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MND1-9934M | Recombinant Mouse MND1 Protein | +Inquiry |
MND1-2616R | Recombinant Rhesus Macaque MND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MND1-4669H | Recombinant Human MND1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MND1-678HCL | Recombinant Human MND1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MND1 Products
Required fields are marked with *
My Review for All MND1 Products
Required fields are marked with *
0
Inquiry Basket