Recombinant Full Length Osmolarity Sensor Protein Envz(Envz) Protein, His-Tagged
Cat.No. : | RFL7323SF |
Product Overview : | Recombinant Full Length Osmolarity sensor protein EnvZ(envZ) Protein (P41406) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MRRMRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD KLQLEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG VSHDLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD LNSVLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNCWIKVSS GTESHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGML EIGTSERGGLSIRAWLPVPVARVQGTTKEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | envZ |
Synonyms | envZ; STY4295; t4005; Sensor histidine kinase EnvZ; Osmolarity sensor protein EnvZ |
UniProt ID | P41406 |
◆ Native Proteins | ||
Pla2-85A | Active Native Apis mellifera Phospholipase A2 | +Inquiry |
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
PLG-252H | Active Native Human Plasminogen | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
IgG1-228H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMTM2-7419HCL | Recombinant Human CMTM2 293 Cell Lysate | +Inquiry |
LSM7-9170HCL | Recombinant Human LSM7 293 Cell Lysate | +Inquiry |
Hypothalamus-459C | Cat Hypothalamus Lysate, Total Protein | +Inquiry |
ZNF548-2048HCL | Recombinant Human ZNF548 cell lysate | +Inquiry |
FATE1-6321HCL | Recombinant Human FATE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All envZ Products
Required fields are marked with *
My Review for All envZ Products
Required fields are marked with *
0
Inquiry Basket