Recombinant Full Length Oryzias Latipes Alpha-1A Adrenergic Receptor(Adra1A) Protein, His-Tagged
Cat.No. : | RFL10427OF |
Product Overview : | Recombinant Full Length Oryzias latipes Alpha-1A adrenergic receptor(adra1a) Protein (Q91175) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryzias latipes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MTPSSVTLNCSNCSHVLAPELNTVKAVVLGMVLGIFILFGVIGNILVILSVVCHRHLQTV TYYFIVNLAVADLLLSSTVLPFSAIFEILDRWVFGRVFCNIWAAVDVLCCTASIMSLCVI SVDRYIGVSYPLRYPAIMTKRRALLAVMLLWVLSVIISIGPLFGWKEPAPEDETVCKITE EPGYAIFSAVGSFYLPLAIILAMYCRVYVVAQKESRGLKEGQKIEKSDSEQVILRMHRGN TTVSEDEALRSRTHFALRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYR PSDTVFKITFWLGYFNSCINPIIYLCSNQEFKKAFQSLLGVHCLRMTPRAHHHHLSVGQS QTQGHSLTISLDSKGAPCRLSPSSSVALSRTPSSRDSREWRVFSGGPINSGPGPTEAGRA KVAKLCNKSLHRTCCCILRARTPTQDPAPLGDLPTIKIHQLSLSEKGESV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | adra1a |
Synonyms | adra1a; Alpha-1A adrenergic receptor; Alpha-1A adrenoreceptor; Alpha-1A adrenoceptor; MAR1 |
UniProt ID | Q91175 |
◆ Recombinant Proteins | ||
IL3-407D | Recombinant Canine IL3 protein | +Inquiry |
OR51A4-3032R | Recombinant Rhesus Macaque OR51A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS2-5157R | Recombinant Rat RPS2 Protein | +Inquiry |
RFL24331GF | Recombinant Full Length Gallid Herpesvirus 2 Virion Egress Protein Ul34 Homolog(Mdv047) Protein, His-Tagged | +Inquiry |
IL15-26H | Active Recombinant Human IL15 Protein, Animal Free | +Inquiry |
◆ Native Proteins | ||
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
Lectin-1804L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 649 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRNAU1AP-750HCL | Recombinant Human TRNAU1AP 293 Cell Lysate | +Inquiry |
Thalamus-518R | Rhesus monkey Thalamus Lysate | +Inquiry |
NEGR1-2116MCL | Recombinant Mouse NEGR1 cell lysate | +Inquiry |
ZNF19-1992HCL | Recombinant Human ZNF19 cell lysate | +Inquiry |
DOCK2-503HCL | Recombinant Human DOCK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All adra1a Products
Required fields are marked with *
My Review for All adra1a Products
Required fields are marked with *
0
Inquiry Basket