Recombinant Full Length Oryza Sativa Subsp. Japonica Upf0496 Protein 3(Os03G0148000, Loc_Os03G05440) Protein, His-Tagged
Cat.No. : | RFL21188OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica UPF0496 protein 3(Os03g0148000, LOC_Os03g05440) Protein (Q10RR9) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MGATFRCFGGCVKPDDQQVHEPKKVVAPSSSFDFREEYTSAFRTESYNDFWARVLDITLA HGAALVPRHGGGGGCAASKRLPSYRLFAEHLLEPDQRAVAAALASPRGSRLRPDVRGLLA AYYAETANASFLCSHLLKDIEHIRLRYRPLKHTLRKLASDVGVSGLADVSAALGQPFTAL AASQGRLREVQAGSGDLLRGLDAGRKKARHRIRSVARLRRALSVSFVTAVAVVAVVGACI GVHILAAFAAFPMMSPAWLGERFFSGRAARRALVQLEAAAKGTYILNRDMETISRLVARV RDEGEHMVALRRLCVEHRPAAGAGGKGRLVQEVLRQLSKNEESFRQQLDELEEHLFLCFM TTNKARIMVMNFMAAAAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Os03g0148000 |
Synonyms | Os03g0148000; LOC_Os03g05440; OsJ_009069; OSJNBa0067N01.1; OSJNBb0050N02.3; UPF0496 protein 3 |
UniProt ID | Q10RR9 |
◆ Recombinant Proteins | ||
RC0497-4716R | Recombinant Rickettsia conorii RC0497 protein, His-SUMO-tagged | +Inquiry |
CHTF8-872R | Recombinant Rhesus monkey CHTF8 Protein, His-tagged | +Inquiry |
HSPD1-041H | Recombinant Human HSPD1 Protein | +Inquiry |
ABCB4-301507H | Recombinant Human ABCB4 protein, GST-tagged | +Inquiry |
PMPCB-4203R | Recombinant Rat PMPCB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
S100A1B-9H | Native Human S100A1B | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF266-2002HCL | Recombinant Human ZNF266 cell lysate | +Inquiry |
KCNA1-5079HCL | Recombinant Human KCNA1 293 Cell Lysate | +Inquiry |
GATA3-6011HCL | Recombinant Human GATA3 293 Cell Lysate | +Inquiry |
TRIM29-1826HCL | Recombinant Human TRIM29 cell lysate | +Inquiry |
H1FOO-2118HCL | Recombinant Human H1FOO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Os03g0148000 Products
Required fields are marked with *
My Review for All Os03g0148000 Products
Required fields are marked with *
0
Inquiry Basket