Recombinant Full Length Oryza Sativa Subsp. Japonica Two Pore Potassium Channel C(Tpkc) Protein, His-Tagged
Cat.No. : | RFL17843OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Two pore potassium channel c(TPKC) Protein (Q69TN4) (1-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-456) |
Form : | Lyophilized powder |
AA Sequence : | MDTEPLLSPLSPSPHLLHPLPEHAEVSTFSPPLSPCPSPASSYKERIIFGAHPPPPPPPP PPPPPPPRGRRYYRRVSGDDLDVPSCSSSPSPPSDEENPPPNPPSLFDFIGGRTNLHRSR TAPAMAPLNAAAIAAAAASGDSRNPPPPPRRPAIVLHAFLFLLAYLAMGVTFYAALPGNF TSSAGPTHPVADALYFCIVTLCTIGYGDITPATPAAKLFSISFVLIGFGFVDILLSGMVS YVLDLQEHLLITALKNPRSVRKHRHNYIFDLKKGRMRVRMKVALALTVVAICVGVGAAVL KRVENLGWLDAVYLAVMSVTTVGYGDHAFRTLAGRLFASAWLLVSTLAVARAFLYLAEMR IDKRHRAMANWVLSRDMTVSEFLAADIDNNGYVTKSEFVVYKLKEMGKISEKDIMMICDQ FQRMDSGNCGKITLSDLLESHQLVTDLNEKKKGKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TPKC |
Synonyms | TPKC; KCO3; Os09g0299400; LOC_Os09g12790; OsJ_28764; OSJNBa0062A09.6; Two pore potassium channel c; Two K(+ channel c; Calcium-activated outward-rectifying potassium channel 3; OsKCO3 |
UniProt ID | Q69TN4 |
◆ Recombinant Proteins | ||
ANO6-9683H | Recombinant Human ANO6, GST-tagged | +Inquiry |
Cpe-784M | Recombinant Mouse Cpe Protein, His-tagged | +Inquiry |
Csf1r-8666M | Recombinant Mouse Csf1r, Fc-His tagged | +Inquiry |
DGCR8-2567H | Recombinant Human DGCR8 Protein, GST-tagged | +Inquiry |
RRAD-30772TH | Recombinant Human RRAD | +Inquiry |
◆ Native Proteins | ||
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
IgG-7437M | Native Mouse IgG Protein | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
HB-01H | Native Human HB Protein | +Inquiry |
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB5-2771HCL | Recombinant Human PSMB5 293 Cell Lysate | +Inquiry |
GTF2H2-5697HCL | Recombinant Human GTF2H2 293 Cell Lysate | +Inquiry |
ZNF773-2023HCL | Recombinant Human ZNF773 cell lysate | +Inquiry |
GOLT1A-300HCL | Recombinant Human GOLT1A lysate | +Inquiry |
RNF4-2276HCL | Recombinant Human RNF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPKC Products
Required fields are marked with *
My Review for All TPKC Products
Required fields are marked with *
0
Inquiry Basket