Recombinant Human RRAD

Cat.No. : RRAD-30772TH
Product Overview : Recombinant fragment of Human RRAD with an N terminal proprietary tag; Predicted MW 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRS IVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYS VTDKGSFEKASELRVQLRRARQTDDVPIIL
Sequence Similarities : Belongs to the small GTPase superfamily. RGK family.
Gene Name RRAD Ras-related associated with diabetes [ Homo sapiens ]
Official Symbol RRAD
Synonyms RRAD; Ras-related associated with diabetes; GTP-binding protein RAD; RAD; REM3;
Gene ID 6236
mRNA Refseq NM_001128850
Protein Refseq NP_001122322
MIM 179503
Uniprot ID P55042
Chromosome Location 16q22
Pathway Insulin Signaling, organism-specific biosystem;
Function GTP binding; GTPase activity; calmodulin binding; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RRAD Products

Required fields are marked with *

My Review for All RRAD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon