Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Xyloglucan Glycosyltransferase 2(Cslc2) Protein, His-Tagged
Cat.No. : | RFL893OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Probable xyloglucan glycosyltransferase 2(CSLC2) Protein (Q69L19) (1-698aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-698) |
Form : | Lyophilized powder |
AA Sequence : | MAPPGVGVGVAYLWGKGRGGRKGTPVVVTMESPNYSVVEVDGPDAEAELRTAAVAMDKGG GRGRSRSRTARQLTWVLLLRARRAAGRLASFAAAAARRFRRSPADAADELGRGRGRLMYG FIRGFLALSLLALAVELAAYWNGWRLRRPELHVPEAVEIEGWAHSAYISWMSFRADYIRR PIEFLSKACILLFVIQSMDRLVLCLGCFWIKLRKIKPRIEGDPFREGSGYQHPMVLVQIP MCNEKEVYEQSISAACQLDWPREKFLIQVLDDSSDESIQLLIKAEVSKWSHQGVNIVYRH RVLRTGYKAGNLKSAMSCDYVKDYEFVAIFDADFQPTPDFLKKTIPHFEGNPELGLVQAR WSFVNKDENLLTRLQNINLCFHFEVEQQVNGVFLNFFGFNGTAGVWRIQALEESGGWLER TTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYEAYRKQQHRWHSGPMHLFRLCLPDI LTAKISSWKKANLILLFFLLRKLILPFYSFTLFCVILPLTMFVPEAELPVWVICYVPVCM SFLNILPSPRSFPFIVPYLLFENTMSVTKFNAMVSGLFKLGSSYEWIVTKKSGRSSESDL STAAERDTKDLTLPRLQKQISESELIELKMQKERQEKAPLGAKKANKVYKKELALSLLLL TAATRSLLSAQGIHFYFLLFQGVSFLFVGLDLIGEQID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSLC2 |
Synonyms | CSLC2; Os09g0428000; LOC_Os09g25900; OJ1299_A11.39; OsJ_028287; P0689B09.2; Probable xyloglucan glycosyltransferase 2; Cellulose synthase-like protein C2; OsCslC2 |
UniProt ID | Q69L19 |
◆ Recombinant Proteins | ||
CCR3-1228R | Recombinant Rat CCR3 Protein | +Inquiry |
MVK-5769H | Recombinant Human MVK Protein, GST-tagged | +Inquiry |
HA1-1090I | Recombinant H5N1 (A/Cambodia/V0401301/2011) HA1 Protein, His-tagged | +Inquiry |
MPXV-0001 | Recombinant Monkeypox Virus Protein, Cell surface-binding Protein | +Inquiry |
Tnfaip6-1417M | Recombinant Mouse Tnfaip6 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COG6-7383HCL | Recombinant Human COG6 293 Cell Lysate | +Inquiry |
ITGA3-5134HCL | Recombinant Human ITGA3 293 Cell Lysate | +Inquiry |
OMG-1924HCL | Recombinant Human OMG cell lysate | +Inquiry |
FAHD2A-6468HCL | Recombinant Human FAHD2A 293 Cell Lysate | +Inquiry |
RAB3IP-2595HCL | Recombinant Human RAB3IP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSLC2 Products
Required fields are marked with *
My Review for All CSLC2 Products
Required fields are marked with *
0
Inquiry Basket