Recombinant Full Length Oryza Sativa Subsp. Japonica Potassium Channel Kat3(Os01G0756700, Loc_Os01G55200) Protein, His-Tagged
Cat.No. : | RFL15355OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Potassium channel KAT3(Os01g0756700, LOC_Os01g55200) Protein (Q5JM04) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MPRSSRMNLWPHCFPCFDDGDRSGNRFSTVCNFPDDLLPSLGATAHQPPKLRKYLVSPYD PRYKVWETFLIILVVYSAWICPLEFAFLRYLPSAPFVVDDVVNGFFAVDIMLTFFVPFVD KKSYLLVNDPKKIAVRYLSSWFVFDVCSTVPFHSISLLFNEHGHDLGFKFLNVLRLWRLR RVSSMFARLEKDIRFNYAVIRCTKLISVTLFAIHCAGCINYLIADRYPDPRRTWIGAVMP NFREDGLWIRYVTAMYWSITTLTTTGYGDLHAENAREMLFGICYMLFNLWLTAYLIGNMT NLVVHSTSRTRDFRDVVQAASEFAARNQLPQQIEEQMLNHICLRYKTDGLKQQETLDVLP KAMRSSISHYLFFRVVQGAYLFKGVSSRFIQQLVTEMQAEYFAPKEDIILQNDSPSDLYL LVSGAVDILVFLDGTEQVYRRAAEGELLGEIGVLCNKPQSFTFRTTKLSQILRISRTKLL GIIQENREDGDIIRSNLQQVNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Os01g0756700 |
Synonyms | Os01g0756700; LOC_Os01g55200; OJ1414_E05.9; Potassium channel KAT3 |
UniProt ID | Q5JM04 |
◆ Recombinant Proteins | ||
KRT17-483H | Recombinant Human keratin 17, His-tagged | +Inquiry |
RFL25882CF | Recombinant Full Length Pelodictyon Luteolum Upf0761 Membrane Protein Plut_1323(Plut_1323) Protein, His-Tagged | +Inquiry |
GALK2-5181H | Recombinant Human GALK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SOX1-5905C | Recombinant Chicken SOX1 | +Inquiry |
TCEAL3-411H | Recombinant Human TCEAL3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
AMY2A-8353H | Native Human AMY2A | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTBP1-2728HCL | Recombinant Human PTBP1 293 Cell Lysate | +Inquiry |
ZNF500-63HCL | Recombinant Human ZNF500 293 Cell Lysate | +Inquiry |
PLSCR3-1381HCL | Recombinant Human PLSCR3 cell lysate | +Inquiry |
MRPL9-4154HCL | Recombinant Human MRPL9 293 Cell Lysate | +Inquiry |
Fetal Rectum -158H | Human Fetal Rectum Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Os01g0756700 Products
Required fields are marked with *
My Review for All Os01g0756700 Products
Required fields are marked with *
0
Inquiry Basket