Recombinant Full Length Pelodictyon Luteolum Upf0761 Membrane Protein Plut_1323(Plut_1323) Protein, His-Tagged
Cat.No. : | RFL25882CF |
Product Overview : | Recombinant Full Length Pelodictyon luteolum UPF0761 membrane protein Plut_1323(Plut_1323) Protein (Q3B399) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium luteolum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MAPGSNGIMDGMHRRIGEAGAFFRSFVPFFLQNVRHDRIFLSAGSLAFQTLLSIVPLLAV VLSILNVFAVFAPLQPYVEDFIVHNFVPGTGGMIREYFSGFIGNTFTMPIFGALFLFIVA LVLISTVDHTLNEIWEVHSPRKVLQGFTLYWTVLTLGPVLLATSLAASSFVWYTVFTEGP LLELKTRLLSLLPSTITVLALLLLYLLVPNRRVRFLHALSGALVATLLFEVSKRWFAFYV ANVATFEHIYGALSVIPMLFFWIYLGWVVVLTGAEIVYCLGARRLSGPAAPEFDPLRGVP LMLAVLRMVWRAGGEGVVLDMKKILREFHRENPSSLRKIVDILLECRFMHLTASGGMAAA SDLHVMTLYDLFIKLPPDFGAEDFGQAGPAWDGIELQGVRERLGACFEESMHVPLIQLMD GSNEGQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plut_1323 |
Synonyms | Plut_1323; UPF0761 membrane protein Plut_1323 |
UniProt ID | Q3B399 |
◆ Recombinant Proteins | ||
KDM6B-0525H | Recombinant Human KDM6B Protein (D1141-L1636), Tag Free | +Inquiry |
DEFB126-206C | Recombinant Cynomolgus Monkey DEFB126 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX5A-5140H | Recombinant Human COX5A protein, GST-tagged | +Inquiry |
NDUFAF1-1229H | Recombinant Human NDUFAF1, GST-tagged | +Inquiry |
GKAP1-4939H | Recombinant Human GKAP1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRTAP12-1-4854HCL | Recombinant Human KRTAP12 293 Cell Lysate | +Inquiry |
AP3S1-8808HCL | Recombinant Human AP3S1 293 Cell Lysate | +Inquiry |
TMLHE-918HCL | Recombinant Human TMLHE 293 Cell Lysate | +Inquiry |
THG1L-1096HCL | Recombinant Human THG1L 293 Cell Lysate | +Inquiry |
TSC22D1-724HCL | Recombinant Human TSC22D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Plut_1323 Products
Required fields are marked with *
My Review for All Plut_1323 Products
Required fields are marked with *
0
Inquiry Basket