Recombinant Full Length Oryza Sativa Subsp. Japonica Metal Tolerance Protein 7(Mtp7) Protein, His-Tagged
Cat.No. : | RFL3370OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Metal tolerance protein 7(MTP7) Protein (Q9LDU0) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MGSRGRRGGGERETETEEDETWKLRVGDDFTVPERFHRKPPFFSRIFPAGSHGKHRKIAK YYKKQENLLKDFSEMETMNEIGSLDQNAPTEEELRQMAKGERLAINLSNIINLILFIGKV LASVESLSMAVIASTLDSLLDLLSGFILWFTAHAMKKPNKYSYPIGKRRMQPVGIIVFAS VMGTLGFQVLIESGRQLITNEHQVFDHRKELWMIGSMSSVAVVKFFLMLYCRSFKNEIVR AYAQDHFFDVITNSVGLVSALLAVRYKWWMDPVGAILIAVYTITTWARTVVENVGTLIGR SAPAEYLTKLTYLIWNHHEEIRHIDTVRAYTFGTHYFVEVDIVLPGDMPLSHAHDIGESL QEKLEQLPEVERAFVHVDFEFTHRPEHKAEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTP7 |
Synonyms | MTP7; Os01g0130000; LOC_Os01g03914; OsJ_00239; P0408F06.28; P0504H10.3; Metal tolerance protein 7; OsMTP7 |
UniProt ID | Q9LDU0 |
◆ Recombinant Proteins | ||
TMEM251-17025M | Recombinant Mouse TMEM251 Protein | +Inquiry |
DNAAF2-2720H | Recombinant Human DNAAF2 Protein, GST-tagged | +Inquiry |
PRPH2-1981H | Recombinant Human PRPH2, His-tagged | +Inquiry |
RFL16207CF | Recombinant Full Length Citrobacter Koseri Probable Intracellular Septation Protein A (Cko_01331) Protein, His-Tagged | +Inquiry |
ARMC7-2911H | Recombinant Human ARMC7 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Trachea-629R | Rat Trachea Lysate, Total Protein | +Inquiry |
Heart-210G | Guinea Pig Heart Lysate | +Inquiry |
SLIT2-1683HCL | Recombinant Human SLIT2 293 Cell Lysate | +Inquiry |
SERPINA3C-2499MCL | Recombinant Mouse SERPINA3C cell lysate | +Inquiry |
SIAH1-1851HCL | Recombinant Human SIAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MTP7 Products
Required fields are marked with *
My Review for All MTP7 Products
Required fields are marked with *
0
Inquiry Basket