Recombinant Full Length Serpentine Receptor Class Epsilon-37(Sre-37) Protein, His-Tagged
Cat.No. : | RFL29590CF |
Product Overview : | Recombinant Full Length Serpentine receptor class epsilon-37(sre-37) Protein (O17818) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MVVIYLNSTGNTYWIPIYSLNDKIREPYIFYVFAIFQTSIYILTGYILVRICWIFLTIKV FHDNMNIMMCWFLCQWFQAFLAKIVLIPYQFGIIKISMDINKTYYDWWSDTVEKSAILRE DVNIWPIYFASYFLWHYMYSILFAVLAVGLERVCATWYIQDYEHVSRRHIPILLIAATNL ITLPYAYQTTNNRTPLLQTCLQSIFIGSVAVFGYIMLWRVNLAWRNRIVNLKFTHNEKYS LARKFQIEENIKSLILARKLVVSASVFILVVTILLAVLLFDPHGYDAFFVHALDNSMLLP ALVMSLTLLSCSPAWKERFISGLPIIRRLKSSSVAHQNSYSTASSAGKETEAYFEQLRSS WA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sre-37 |
Synonyms | sre-37; F15A4.3; Serpentine receptor class epsilon-37; Protein sre-37 |
UniProt ID | O17818 |
◆ Recombinant Proteins | ||
PRSS2-4398R | Recombinant Rat PRSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21458MF | Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1282.1 (Mj1282.1) Protein, His-Tagged | +Inquiry |
CNOT1-4731C | Recombinant Chicken CNOT1 | +Inquiry |
TNFRSF9-1509R | Recombinant Rhesus Monkey TNFRSF9 Protein, hIgG1-tagged | +Inquiry |
PXK-5217Z | Recombinant Zebrafish PXK | +Inquiry |
◆ Native Proteins | ||
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP4-436HCL | Recombinant Human VAMP4 293 Cell Lysate | +Inquiry |
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
UNC13D-501HCL | Recombinant Human UNC13D 293 Cell Lysate | +Inquiry |
Heart-215R | Rat Heart Membrane Lysate | +Inquiry |
ADH5-30HCL | Recombinant Human ADH5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sre-37 Products
Required fields are marked with *
My Review for All sre-37 Products
Required fields are marked with *
0
Inquiry Basket