Recombinant Full Length Oryza Sativa Subsp. Japonica Abc Transporter B Family Member 25(Osabcb25) Protein, His-Tagged
Cat.No. : | RFL21451OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica ABC transporter B family member 25(OsABCB25) Protein (Q9FNU2) (1-641aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-641) |
Form : | Lyophilized powder |
AA Sequence : | MGKNLRIKTGNRAPLLAQGETSRALSDLEEGSNVQPENVGFCRVIKLARHDAGKLVIATM ALLVASLSNILVPKYGGKIIDIVSRDVRRPEDKAQALDDVTGTILYIVIIVVTGSVCTAL RAWLFNSASERVVARLRKDLFSHLVNQEIAFFDVTRTGELLSRLSEDTQIIKNAATTNLS EALRNITTTSIGLGFMFATSWKLTLLALVIVPVISIAVRKFGRFLRELSHQTQAAAAVAS SIAEESFGAIRTVRSFAQESHEVLRYGEKVDETLKLGLKQAKVVGMFSGGLNAASTLSVV IVVIYGANLTINGYMTTGSLTSFILYSLTVGSSVSALSGLYTTVMKASGASRRVFQLLDR VSSMANSGDRCPTNENDGEVELDDVWFAYPSRPSHMILKGITLKLTPGSKVALVGPSGGG KTTIANLIERFYDPLKGRILLNGVPLPEISHQFLHRKVSIVSQEPVLFNCSIEENIAYGL EGKASSADVENAAKMANAHNFICSFPDQYKTVVGERGIRLSGGQKQRVAIARALLMNPRV LLLDEATSALDAESEYLVQDAMDSLMKGRTVLVIAHRLSTVKSADTVAVISDGQIVESGT HDELLSRDGIYTALVKRQLQGPRFEGTSNATAEIEPISNGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OsABCB25 |
Synonyms | ABCB25; ALS1; Os03g0755100; LOC_Os03g54790; OSJNBb0081K01.19; ABC transporter B family member 25; ABC transporter ABCB.25; OsABCB25; Protein ALS1 homolog; Protein ALUMINUM SENSITIVE 1; OsALS1 |
UniProt ID | Q9FNU2 |
◆ Recombinant Proteins | ||
env-4194H | Recombinant HIV-1 env protein, His-SUMO-tagged | +Inquiry |
SPBC-0604B | Recombinant Bacillus subtilis SPBC protein, His-tagged | +Inquiry |
Irs1-7871M | Recombinant Mouse Irs1 protein, His & T7-tagged | +Inquiry |
ARFGAP2-3542Z | Recombinant Zebrafish ARFGAP2 | +Inquiry |
RFL31625CF | Recombinant Full Length Serpentine Receptor Class Beta-6(Srb-6) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
REN -16H | Recombinant Human Prorenin, His-tagged | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
HP-133B | Native Bovine Haptoglobin | +Inquiry |
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
CERK-7567HCL | Recombinant Human CERK 293 Cell Lysate | +Inquiry |
DPPA3P2-640HCL | Recombinant Human DPPA3P2 lysate | +Inquiry |
Ovary-354C | Cynomolgus monkey Ovary Membrane Lysate | +Inquiry |
SHMT1-1855HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
PLK1-703HCL | Recombinant Human PLK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OsABCB25 Products
Required fields are marked with *
My Review for All OsABCB25 Products
Required fields are marked with *
0
Inquiry Basket