Recombinant Full Length Oryza Sativa Subsp. Indica Magnesium Transporter Mrs2-A, Chloroplastic(Mrs2-A) Protein, His-Tagged
Cat.No. : | RFL4573OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Magnesium transporter MRS2-A, chloroplastic(MRS2-A) Protein (B8APK3) (56-474aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (56-474) |
Form : | Lyophilized powder |
AA Sequence : | AAGRGGAGGLLLLPPLPALRAAEGKDGRAVTKDEEEEAAAAAVEEEGEVEVRREEDKPGD DGSREAAARGSGSGRFSADYISLGIREPVYEVIEVKSNGRMSTKKISRRQLLKSSGLRLR DTRSVDPSLWLMNSMPSLLVREQAILVNLGSLRAIAMHERVLIFNYNSPGGKAFLDSLLP RLNPRNINGGPAMPFQLEVVEAALLSRIQRLERRLMRIEPRVGALLEVLPNRLTADVLEQ LRLSKQALVELGSRAGDLKQMLIDLLDDPHEIRRICIMGRNCTLDKLSDNMECSVPLEKQ IAEEEEEEIEMLLENYLQRCESIHGQAERLLDSAREMEDSIAVNLSSRRLEVSRVELLLQ VGTFCVAIGALIAGIFGMNLKSYLETNAWAFWATTGGIVVGAVAGFFIMYSYLKTRKIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-A |
Synonyms | MRS2-A; OsI_13056; Magnesium transporter MRS2-A, chloroplastic |
UniProt ID | B8APK3 |
◆ Recombinant Proteins | ||
RFL34743EF | Recombinant Full Length Enterobacter Sp. Fumarate Reductase Subunit C(Frdc) Protein, His-Tagged | +Inquiry |
CYB5B-4122M | Recombinant Mouse Cyb5b Protein, C-Myc/DDK tagged | +Inquiry |
CUL2-2397HF | Recombinant Full Length Human CUL2 Protein, GST-tagged | +Inquiry |
MVB12B-2381C | Recombinant Chicken MVB12B | +Inquiry |
ILVBL-3048B | Recombinant Bovine ILVBL, His-tagged | +Inquiry |
◆ Native Proteins | ||
F10-296M | Active Native Mouse Factor Xa | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
LDLc-01H | Native Human Low-Density Lipoprotein cholesterol | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-515R | Rat Testis Membrane Lysate | +Inquiry |
FUT3-6114HCL | Recombinant Human FUT3 293 Cell Lysate | +Inquiry |
RGS20-2377HCL | Recombinant Human RGS20 293 Cell Lysate | +Inquiry |
HSPB11-5350HCL | Recombinant Human HSPB11 293 Cell Lysate | +Inquiry |
KLHL9-946HCL | Recombinant Human KLHL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MRS2-A Products
Required fields are marked with *
My Review for All MRS2-A Products
Required fields are marked with *
0
Inquiry Basket